Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine/threonine-protein phosphatase PP1-beta catalytic subunit  

UniProtKB / Swiss-Prot ID :  PP1B_CANFA

Gene Name (Synonyms) : 
PPP1CB  

Species :  Canis familiaris (Dog) (Canis lupus familiaris). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). Nucleus, nucleoplasm (By similarity). Nucleus, nucleolus (By similarity). Note=Highly mobile in cells and can be relocalized through interaction with targeting subunits. In the presence of PPP1R8 reloca 

Protein Function :  Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase (By similarity). 

Protein Sequence MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCEEEECCCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures