Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Low molecular weight phosphotyrosine protein phosphatase  

UniProtKB / Swiss-Prot ID :  PPAC_MOUSE

Gene Name (Synonyms) : 
Acp1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates (By similarity). 

Protein Sequence MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIH...
Predicted Secondary Structure CCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHCCCC...
Protein Variant
LocationDescription
14L -> P.
157T -> P.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
132PhosphotyrosineIEDPYYGND
CCCCCCCCH
36.01Phosphositeplus
Link
132PhosphotyrosineIEDPYYGND
CCCCCCCCH
36.01SysPTM
Link
133PhosphotyrosineEDPYYGNDS
CCCCCCCHH
18.16Phosphositeplus
Link
133PhosphotyrosineEDPYYGNDS
CCCCCCCHH
18.16SysPTM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures