Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Alkaline phosphatase, placental type  

UniProtKB / Swiss-Prot ID :  PPB1_HUMAN

Gene Name (Synonyms) : 
ALPP, PLAP  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :   

Transmembrane Topology (topPTM) : PPB1_HUMAN 

Protein Sequence MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCHH...
Protein Variant
LocationDescription
25P -> L (in dbSNP:rs1130335). VAR_017419
89I -> L (in dbSNP:rs13026692). VAR_050520
231R -> P (in dbSNP:rs1048988). VAR_050521
263R -> H (in dbSNP:rs2853378). VAR_050522
451E -> G (in dbSNP:rs1048994). VAR_050523
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
114PhosphoserineHVPDSGATA
CCCCCHHHH
25.02HPRD
Link
114PhosphoserineHVPDSGATA
CCCCCHHHH
25.02PhosphoELM
Link
114Phosphoserine.HVPDSGATA
CCCCCHHHH
25.02UniProtKB
Link
117PhosphothreonineDSGATATAY
CCHHHHHHH
28.24HPRD
Link
117PhosphothreonineDSGATATAY
CCHHHHHHH
28.24PhosphoELM
Link
119PhosphothreonineGATATAYLC
HHHHHHHHH
16.10HPRD
Link
273PhosphothreonineVWNRTELMQ
EECHHHHHH
30.20HPRD
Link
283PhosphoserineSLDPSVTHL
CCCCCCCEE
39.04HPRD
Link
297Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)PGDMKYEIH
CCCCEEEEC
44.46HPRD
Link
314PhosphothreonineLMEMTEAAL
HHHHHHHHH
14.79HPRD
Link
410PhosphotyrosineDRKAYTVLL
CCCCEEEEE
10.62HPRD
Link
415PhosphotyrosineTVLLYGNGP
EEEECCCCC
12.37HPRD
Link
421PhosphotyrosineNGPGYVLKD
CCCCCEECC
13.02HPRD
Link
506GPI-anchor amidated aspartate.AGTTDAAHP
CCCCCCCCC
41.41UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TPP1_HUMANcolocalizationMINT-4054731MINT17174955
A2MG_HUMANcolocalizationMINT-4054731MINT17174955
GLCM_HUMANcolocalizationMINT-4054731MINT17174955
APOD_HUMANcolocalizationMINT-4054731MINT17174955
ADT2_HUMANcolocalizationMINT-4054731MINT17174955
PERM_HUMANcolocalizationMINT-4054731MINT17174955
CATG_HUMANcolocalizationMINT-4054731MINT17174955
CH60_HUMANcolocalizationMINT-4054731MINT17174955
GRP78_HUMANcolocalizationMINT-4054731MINT17174955
KCRU_HUMANcolocalizationMINT-4054731MINT17174955
BGAL_HUMANcolocalizationMINT-4054731MINT17174955
CAP7_HUMANcolocalizationMINT-4054731MINT17174955
VATB2_HUMANcolocalizationMINT-4054731MINT17174955
AOFA_HUMANcolocalizationMINT-4054731MINT17174955
VDAC1_HUMANcolocalizationMINT-4054731MINT17174955
PRTN3_HUMANcolocalizationMINT-4054731MINT17174955
VATA_HUMANcolocalizationMINT-4054731MINT17174955
VA0D1_HUMANcolocalizationMINT-4054731MINT17174955
ASAH1_HUMANcolocalizationMINT-4054731MINT17174955
SCRB2_HUMANcolocalizationMINT-4054731MINT17174955
ARL8B_HUMANcolocalizationMINT-4054731MINT17174955
PPB1_HUMANin vitroHPRD:01380HPRD12372831
GCH1_HUMANENSP00000295450STRING
PTPS_HUMANENSP00000295450STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Selectivity of the cleavage/attachment site of phosphatidylinositol-glycan-anchored membrane proteins determined by site-specificmutagenesis at Asp-484 of placental alkaline phosphatase.";
Micanovic R., Gerber L.D., Berger J., Kodukula K., Udenfriend S.;
Proc. Natl. Acad. Sci. U.S.A. 87:157-161(1990).
Cited for: GPI-ANCHOR AT ASP-506.
"Site-specific mutations in the COOH-terminus of placental alkalinephosphatase: a single amino acid change converts aphosphatidylinositol-glycan-anchored protein to a secreted protein.";
Lowe M.E.;
J. Cell Biol. 116:799-807(1992).
Cited for: EFFECT OF MUTAGENESIS OF C-TERMINAL PEPTIDE ON GPI-ANCHORING.
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures