Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Pyruvate, phosphate dikinase 1, chloroplastic  

UniProtKB / Swiss-Prot ID :  PPDK1_MAIZE

Gene Name (Synonyms) : 
PPDK1, C4PPDKZM1, CYPPDKZM1  

Species :  Zea mays (Maize). 

Subcellular Localization :  Plastid, chloroplast. Cytoplasm. Note=Isoform 1 is targeted to the chloroplast while isoform 2 is found in the cytoplasm. 

Protein Function :  Formation of phosphoenolpyruvate, which is the primary acceptor of CO(2) in C4 and some Crassulacean acid metabolism plants. 

Protein Sequence MAASVSRAICVQKPGSKCTRDREATSFARRSVAAPRPPHAKAAGVIRSDSGAGRGQHCSPLRAVVDAAPI...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
527Phosphothreonine; by PDRP1.RGGMTSHAA
22.19UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Sequence of the phosphothreonyl regulatory site peptide from inactivemaize leaf pyruvate, orthophosphate dikinase.";
Roeske C.A., Kutny R.M., Budde R.J.A., Chollet R.;
J. Biol. Chem. 263:6683-6687(1988).
Cited for: PROTEIN SEQUENCE OF 521-535, AND PHOSPHORYLATION AT THR-527.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures