Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Peroxiredoxin-2  

UniProtKB / Swiss-Prot ID :  PRDX2_HUMAN

Gene Name (Synonyms) : 
PRDX2, NKEFB, TDPX1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). 

Protein Sequence MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC...
Predicted Secondary Structure CCCCCCEECCCCCCCEEEEEECCCCCEEEEHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCC...
Protein Variant
LocationDescription
153D -> E (in dbSNP:rs34012472). VAR_025051
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASGNA
---CCCCCC
26.58UniProtKB
Link
16Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)APDFKATAV
CCCCEEEEE
52.81Phosphositeplus
Link
18O-linked (GlcNAc)DFKATAVVD
CCEEEEEEC
22.15Phosphositeplus
Link
89PhosphothreonineAWINTPRKE
HHHHHHHHC
18.48Phosphositeplus
Link
92Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NTPRKEGGL
HHHHHCCCC
63.01Phosphositeplus
Link
112O-linked (GlcNAc)TRRLSEDYG
CCHHHHHCC
26.98Phosphositeplus
Link
112PhosphoserineTRRLSEDYG
CCHHHHHCC
26.98Phosphositeplus
Link
119Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YGVLKTDEG
CCCCCCCCC
52.07Phosphositeplus
Link
135Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IIDGKGVLR
EECCCCEEE
41.94Phosphositeplus
Link
193PhosphotyrosineDSKEYFSKH
HHHHHHHCC
19.52Phosphositeplus
Link
195PhosphoserineKEYFSKHN
HHHHHCCC
31.91Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
THIO_HUMANdirect interactionMINT-5115275MINT17557078
CDN1A_HUMANENSP00000301522STRING
HDAC9_HUMANENSP00000301522STRING
P53_HUMANENSP00000301522STRING
H2A2C_HUMANENSP00000301522STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures