Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DNA-dependent protein kinase catalytic subunit  

UniProtKB / Swiss-Prot ID :  PRKDC_HUMAN

Gene Name (Synonyms) : 
PRKDC, HYRC, HYRC1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. Nucleus, nucleolus. 

Protein Function :  Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. 

Protein Sequence MAGSGAGVRCSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFSRDFGLLVFVR...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCHHHHHH...
Protein Variant
LocationDescription
6A -> S (in dbSNP:rs8177999). VAR_019179
263K -> N (in a lung adenocarcinoma sample;somatic mutation).
333M -> I (in dbSNP:rs8178017). VAR_019180
420V -> I (in dbSNP:rs55925466). VAR_041603
500G -> S (in a metastatic melanoma sample;somatic mutation).
605T -> S (in dbSNP:rs8178033). VAR_019181
649F -> L (in dbSNP:rs55811715). VAR_041605
680I -> M (in dbSNP:rs8178040). VAR_019182
695P -> S (in dbSNP:rs8178046). VAR_019183
1071N -> S (in dbSNP:rs8178070). VAR_019184
1136R -> H (in a colorectal adenocarcinomasample; somatic mutation).
1190L -> V (in dbSNP:rs34598508). VAR_041607
1237A -> T. VAR_041608
1279L -> F. VAR_041609
1314G -> V (in dbSNP:rs8178090). VAR_019185
1447R -> M (in a lung squamous cell carcinomasample; somatic mutation).
1588D -> V (in dbSNP:rs8178104). VAR_019186
1603Q -> H (in dbSNP:rs8178106). VAR_019187
1619A -> G (in dbSNP:rs56182356). VAR_041611
1680A -> V (in a metastatic melanoma sample;somatic mutation; dbSNP:rs55735910).
2023S -> P (in dbSNP:rs56042895). VAR_041613
2095A -> V (in dbSNP:rs8178147). VAR_019188
2598R -> Q (in dbSNP:rs55923149). VAR_041614
2702K -> E (in dbSNP:rs8178178). VAR_019189
2810S -> N (in a metastatic melanoma sample;somatic mutation).
2899R -> C (in dbSNP:rs4278157). VAR_019190
2941G -> A (in a lung neuroendocrinecarcinoma sample; somatic mutation).
3085E -> D (in dbSNP:rs56135402). VAR_041617
3149G -> D (in dbSNP:rs8178208). VAR_019191
3198T -> S (in dbSNP:rs55793951). VAR_041618
3201P -> S (in dbSNP:rs8178216). VAR_019192
3404G -> E (in dbSNP:rs8178225). VAR_019193
3434I -> T (in dbSNP:rs7830743). VAR_019194
3459N -> S (in dbSNP:rs8178228). VAR_019195
3562L -> M (in dbSNP:rs8178232). VAR_019196
3584L -> F. VAR_041619
3702P -> L (in dbSNP:rs8178236). VAR_050534
3800L -> I. VAR_041620
3836P -> L (in dbSNP:rs8178245). VAR_019197
3932M -> V. VAR_019198
3936G -> S. VAR_041621
3937V -> M. VAR_041622
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGSGA
---CCCCCC
31.96UniProtKB
Link-
25S-nitrosocysteineAADRCGAAL
HHHCCCHHH
4.47dbSNO
Link-
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KMGQKIAPY
HHCCCCCCC
34.80Phosphositeplus
Link-
108Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SVEIKNTCT
EEEHHHHEE
32.47Phosphositeplus
Link-
117Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SVYTKDRAA
EEEECCCCC
27.77Phosphositeplus
Link-
117N6-acetyllysineSVYTKDRAA
EEEECCCCC
27.77HPRD
Link-
117N6-acetyllysineSVYTKDRAA
EEEECCCCC
27.77Phosphositeplus
Link-
117N6-acetyllysine.SVYTKDRAA
EEEECCCCC
27.77UniProtKB
Link-
137PhosphothreonineKLLQTFRSS
HHHHHHHHH
22.45HPRD
Link-
137PhosphothreonineKLLQTFRSS
HHHHHHHHH
22.45Phosphositeplus
Link-
148Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MDEFKIGEL
HHHHHHHHH
47.99Phosphositeplus
Link-
155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELFSKFYGE
HHHHHHHHH
34.96Phosphositeplus
Link-
163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELALKKKIP
HHHHHCCCC
46.54Phosphositeplus
Link-
205Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGELKTQMT
HHHHHHHHH
32.20Phosphositeplus
Link-
225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AGCLKGLSS
HHHHHHHHH
62.98Phosphositeplus
Link-
229PhosphoserineKGLSSLLCN
HHHHHHHHH
30.33HPRD
Link-
254Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NFVLKAIRP
HHHHHHHCC
36.14Phosphositeplus
Link-
254N6-acetyllysineNFVLKAIRP
HHHHHHHCC
36.14HPRD
Link-
254N6-acetyllysineNFVLKAIRP
HHHHHHHCC
36.14Phosphositeplus
Link-
254N6-acetyllysine.NFVLKAIRP
HHHHHHHCC
36.14UniProtKB
Link-
263Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QIDLKRYAV
HHHHHHHHH
39.35Phosphositeplus
Link-
310Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VELKKAALS
HHHHHHHHH
52.06Phosphositeplus
Link-
329Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NMVAKNAEM
HHHHHHHHH
45.33Phosphositeplus
Link-
357Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DSNNKELSI
CCCCCEEEE
65.37Phosphositeplus
Link-
379Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VINAKDVDF
HCCCCCHHH
54.52Phosphositeplus
Link-
471Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALAAKGPVL
HHCCCCCHH
59.13Phosphositeplus
Link-
478S-nitrosocysteineVLRNCISTV
HHHHHHHHH
1.78dbSNO
Link-
511PhosphoserineDHRASGEVR
CCCCCCCCC
35.13Phosphositeplus
Link-
511Phosphoserine.DHRASGEVR
CCCCCCCCC
35.13UniProtKB
Link-
525Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPTYKDYVD
CCCHHHHHH
45.09Phosphositeplus
Link-
574Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KSVLKIVEK
HHHHHHHHH
42.42Phosphositeplus
Link-
681Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AKKIKYFEG
HHHHHHHCC
53.41Phosphositeplus
Link-
689Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GVSPKSLKH
CCCHHHHCC
62.00Phosphositeplus
Link-
692Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PKSLKHSPE
HHHHCCCCC
49.48Phosphositeplus
Link-
712Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VKFGKEVAV
HHHHHHHHH
52.74Phosphositeplus
Link-
795S-nitrosocysteineDILPCLDGY
HHHHHHHHH
4.92dbSNO
Link-
801Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DGYLKTSAL
HHHHHHCCC
31.76Phosphositeplus
Link-
810Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SDETKNNWE
CCCCCCCCH
46.35Phosphositeplus
Link-
8205-methylarginineSALSRAAQK
HHHHHHHHH
34.49Phosphositeplus
Link-
828N6-acetyllysineKGFNKVVLK
HHHHHHHHH
31.31HPRD
Link-
828N6-acetyllysineKGFNKVVLK
HHHHHHHHH
31.31Phosphositeplus
Link-
828N6-acetyllysine.KGFNKVVLK
HHHHHHHHH
31.31UniProtKB
Link-
832N6-acetyllysineKVVLKHLKK
HHHHHHHHH
34.97HPRD
Link-
832N6-acetyllysineKVVLKHLKK
HHHHHHHHH
34.97Phosphositeplus
Link-
832N6-acetyllysine.KVVLKHLKK
HHHHHHHHH
34.97UniProtKB
Link-
838Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKKTKNLSS
HHHHHCCCC
65.85Phosphositeplus
Link-
841PhosphoserineTKNLSSNEA
HHCCCCCCC
40.28Phosphositeplus
Link-
841Phosphoserine.TKNLSSNEA
HHCCCCCCC
40.28UniProtKB
Link-
868Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GQINKNLLT
CHHCCHHEE
51.07Phosphositeplus
Link-
881Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DEMMKSYVA
HHHHHHHHH
37.01Phosphositeplus
Link-
883PhosphotyrosineMMKSYVAWD
HHHHHHHHH
6.67Phosphositeplus
Link-
893PhosphoserineEKRLSFAVP
CCCCEEECC
18.39HPRD
Link-
893PhosphoserineEKRLSFAVP
CCCCEEECC
18.39PhosphoELM
Link-
893PhosphoserineEKRLSFAVP
CCCCEEECC
18.39Phosphositeplus
Link-
893PhosphoserineEKRLSFAVP
CCCCEEECC
18.39SysPTM
Link-
893Phosphoserine.EKRLSFAVP
CCCCEEECC
18.39UniProtKB
Link-
902Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FREMKPVIF
HHHCCCCEE
31.23Phosphositeplus
Link-
963Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YQLYKRTFP
HHHHHHHHH
54.26Phosphositeplus
Link-
1038Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)REFLKWSIK
HHHHHHHHH
44.19Phosphositeplus
Link-
1042Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KWSIKQITP
HHHHHCCCC
30.08Phosphositeplus
Link-
1051Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QQQEKSPVN
HHHHCCCCC
56.58Phosphositeplus
Link-
1052PhosphoserineQQEKSPVNT
HHHCCCCCH
33.07HPRD
Link-
1052PhosphoserineQQEKSPVNT
HHHCCCCCH
33.07Phosphositeplus
Link-
1052PhosphoserineQQEKSPVNT
HHHCCCCCH
33.07SysPTM
Link-
1052Phosphoserine.QQEKSPVNT
HHHCCCCCH
33.07UniProtKB
Link-
1057Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PVNTKSLFK
CCCHHHHHH
39.70Phosphositeplus
Link-
1057N6-acetyllysinePVNTKSLFK
CCCHHHHHH
39.70HPRD
Link-
1057N6-acetyllysinePVNTKSLFK
CCCHHHHHH
39.70Phosphositeplus
Link-
1057N6-acetyllysine.PVNTKSLFK
CCCHHHHHH
39.70UniProtKB
Link-
1074Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PNAFKRLGA
CHHHHHHHH
44.28Phosphositeplus
Link-
1186Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ECRHKSIEL
HHHHHHHHH
33.50Phosphositeplus
Link-
1193Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELFYKFVPL
HHHHHHHCC
32.33Phosphositeplus
Link-
1209Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NLWLKDVLK
HHHHHHHHH
33.92Phosphositeplus
Link-
1209N6-acetyllysineNLWLKDVLK
HHHHHHHHH
33.92HPRD
Link-
1209N6-acetyllysineNLWLKDVLK
HHHHHHHHH
33.92Phosphositeplus
Link-
1209N6-acetyllysine.NLWLKDVLK
HHHHHHHHH
33.92UniProtKB
Link-
1275PhosphothreonineIGERTVGAL
HHHHHCCCH
20.99HPRD
Link-
1311Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IAAEKCFGT
HHHHHHCCC
30.09Phosphositeplus
Link-
1334Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YNYSKCTVV
CCCCHHHHH
24.46Phosphositeplus
Link-
1352PhosphoserineLLNTSPEGW
HHHHCHHHH
21.63HPRD
Link-
1357Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PEGWKLLKK
HHHHHHHHH
55.59Phosphositeplus
Link-
1407Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MKALKMSPY
HHHHCCCCH
42.04Phosphositeplus
Link-
1412Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MSPYKDILE
CCCHHHHHH
41.50Phosphositeplus
Link-
1456Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VSACKQLHR
HHHHHHHHH
56.46Phosphositeplus
Link-
1489Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLVYKGIAP
HHHHHHCCC
36.04Phosphositeplus
Link-
1499S-nitrosocysteineDERQCLPSL
CHHHHCCCC
8.27dbSNO
Link-
1507S-nitrosocysteineLDLSCKQLA
CCCCHHHHH
4.18dbSNO
Link-
1612Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RANQKHQGL
HHHHHHHHH
37.39Phosphositeplus
Link-
1620PhosphothreonineLKLATTILQ
HHHHHHHHH
25.46Phosphositeplus
Link-
1621PhosphothreonineKLATTILQH
HHHHHHHHH
17.68Phosphositeplus
Link-
1627Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQHWKKCDS
HHHHHHHHH
41.20Phosphositeplus
Link-
1642Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PLETKMAVL
CCHHHHHHH
18.58Phosphositeplus
Link-
1694PhosphothreonineGQAVTLLPF
CCEEEEEEE
26.12HPRD
Link-
1700PhosphothreonineLPFFTSLTG
EEECCCCCC
24.17HPRD
Link-
1701PhosphoserinePFFTSLTGG
EECCCCCCC
20.83HPRD
Link-
1703PhosphothreonineFTSLTGGSL
CCCCCCCCH
38.98HPRD
Link-
1841PhosphoserineREFFSTIVV
HHHHHHHHH
23.65HPRD
Link-
1842PhosphothreonineEFFSTIVVD
HHHHHHHHH
16.79HPRD
Link-
1857Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SRFTKLNES
HHHHCCCCH
46.75Phosphositeplus
Link-
1869Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TQITKKMGY
HHHHHHHHH
42.25Phosphositeplus
Link-
1875Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MGYYKILDV
HHHHHHHHH
28.45Phosphositeplus
Link-
1892Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVHAKESKI
HHHHHHHHH
47.87Phosphositeplus
Link-
1913Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NELTKTLIK
HHHHHHHHH
54.69Phosphositeplus
Link-
1970Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LFSEKPEKN
HCCCCCCCC
58.22Phosphositeplus
Link-
1970N6-acetyllysineLFSEKPEKN
HCCCCCCCC
58.22HPRD
Link-
1970N6-acetyllysineLFSEKPEKN
HCCCCCCCC
58.22Phosphositeplus
Link-
1970N6-acetyllysine.LFSEKPEKN
HCCCCCCCC
58.22UniProtKB
Link-
1973Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EKPEKNLLI
CCCCCCCHH
62.51Phosphositeplus
Link-
1985Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIDLKRRYN
HHHHHHHCC
30.95Phosphositeplus
Link-
2020noneNGDSDGPSY
CCCCCCCHH
77.19HPRD
Link-
2056PhosphoserineYSYSSQDPR
CCCCCCCCC
30.30Phosphositeplus
Link-
2056Phosphoserine (DNA-PK)YSYSSQDPR
CCCCCCCCC
30.30PhosphoELM
Link-
2117PhosphoserineGEEDSVPRD
CCCCCCCCC
36.98HPRD
Link-
2117PhosphoserineGEEDSVPRD
CCCCCCCCC
36.98Phosphositeplus
Link-
2117PhosphoserineGEEDSVPRD
CCCCCCCCC
36.98SysPTM
Link-
2117Phosphoserine.GEEDSVPRD
CCCCCCCCC
36.98UniProtKB
Link-
2127Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PSWMKFLHG
HHHHHHHHH
38.22Phosphositeplus
Link-
2132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FLHGKLGNP
HHHHHHCCC
42.34Phosphositeplus
Link-
2259Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIFEKFSGK
HHHHHCCCC
33.80Phosphositeplus
Link-
2259N6-acetyllysineLIFEKFSGK
HHHHHCCCC
33.80HPRD
Link-
2259N6-acetyllysineLIFEKFSGK
HHHHHCCCC
33.80Phosphositeplus
Link-
2259N6-acetyllysine.LIFEKFSGK
HHHHHCCCC
33.80UniProtKB
Link-
2263Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KFSGKDPNS
HCCCCCCCC
69.67Phosphositeplus
Link-
2342S-nitrosocysteineEESLCELVA
HHHHHHHHH
5.45dbSNO
Link-
2347Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELVAKQLKQ
HHHHHHHHH
49.00Phosphositeplus
Link-
2350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AKQLKQHQN
HHHHHHHHC
43.15Phosphositeplus
Link-
2369Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NKVTKSFPP
HHHHCCCCC
53.76Phosphositeplus
Link-
2418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QLKSKDFVQ
EECCHHHHH
54.31Phosphositeplus
Link-
2447Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MPKLKPVEL
HCCCCCHHH
53.82Phosphositeplus
Link-
2503Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FKLAKDVLI
HHHHHHHHH
59.82Phosphositeplus
Link-
2546PhosphotyrosineLNSLYSPKI
HHHHCCCHH
23.81HPRD
Link-
2599PhosphoserineWRFRSTVLT
CCCHHHCCC
21.84HPRD
Link-
2603PhosphothreonineSTVLTPMFV
HHCCCHHHH
14.36HPRD
Link-
2603PhosphothreonineSTVLTPMFV
HHCCCHHHH
14.36HPRD
Link-
2603PhosphothreonineSTVLTPMFV
HHCCCHHHH
14.36PhosphoELM
Link-
2603PhosphothreonineSTVLTPMFV
HHCCCHHHH
14.36Phosphositeplus
Link-
2603PhosphothreonineSTVLTPMFV
HHCCCHHHH
14.36SysPTM
Link-
2603Phosphothreonine.STVLTPMFV
HHCCCHHHH
14.36UniProtKB
Link-
2609PhosphothreonineMFVETQASQ
HHHHHHCCH
24.92HPRD
Link-
2609PhosphothreonineMFVETQASQ
HHHHHHCCH
24.92Phosphositeplus
Link-
2609PhosphothreonineMFVETQASQ
HHHHHHCCH
24.92SysPTM
Link-
2609Phosphothreonine (DNA-PK;DNA-PK;DNA-PK)MFVETQASQ
HHHHHHCCH
24.92PhosphoELM
Link-
2609Phosphothreonine (PRKDC)MFVETQASQ
HHHHHHCCH
24.92HPRD
Link-
2609Phosphothreonine; by autocatalysis.MFVETQASQ
HHHHHHCCH
24.92UniProtKB
Link-
2612PhosphoserineETQASQGTL
HHHCCHHHH
21.23HPRD
Link-
2612PhosphoserineETQASQGTL
HHHCCHHHH
21.23Phosphositeplus
Link-
2612PhosphoserineETQASQGTL
HHHCCHHHH
21.23SysPTM
Link-
2612Phosphoserine (DNA-PK;DNA-PK)ETQASQGTL
HHHCCHHHH
21.23PhosphoELM
Link-
2612Phosphoserine (PRKDC)ETQASQGTL
HHHCCHHHH
21.23HPRD
Link-
2612Phosphoserine; by autocatalysis.ETQASQGTL
HHHCCHHHH
21.23UniProtKB
Link-
2620PhosphothreonineLQTRTQEGS
HHHCCCCCC
34.07Phosphositeplus
Link-
2620Phosphothreonine (DNA-PK;DNA-PK)LQTRTQEGS
HHHCCCCCC
34.07PhosphoELM
Link-
2620Phosphothreonine (PRKDC)LQTRTQEGS
HHHCCCCCC
34.07HPRD
Link-
2624PhosphoserineTQEGSLSAR
CCCCCCCCC
20.56PhosphoELM
Link-
2624PhosphoserineTQEGSLSAR
CCCCCCCCC
20.56Phosphositeplus
Link-
2624Phosphoserine (PRKDC)TQEGSLSAR
CCCCCCCCC
20.56HPRD
Link-
2638PhosphothreonineQIRATQQQH
CHHHHHHHH
19.64HPRD
Link-
2638PhosphothreonineQIRATQQQH
CHHHHHHHH
19.64Phosphositeplus
Link-
2638PhosphothreonineQIRATQQQH
CHHHHHHHH
19.64SysPTM
Link-
2638Phosphothreonine (DNA-PK;DNA-PK)QIRATQQQH
CHHHHHHHH
19.64PhosphoELM
Link-
2638Phosphothreonine (PRKDC)QIRATQQQH
CHHHHHHHH
19.64HPRD
Link-
2638Phosphothreonine; by autocatalysis.QIRATQQQH
CHHHHHHHH
19.64UniProtKB
Link-
2645PhosphothreonineQHDFTLTQT
HHCCCCCCC
34.65HPRD
Link-
2645PhosphothreonineQHDFTLTQT
HHCCCCCCC
34.65Phosphositeplus
Link-
2645PhosphothreonineQHDFTLTQT
HHCCCCCCC
34.65SysPTM
Link-
2647PhosphothreonineDFTLTQTAD
CCCCCCCCC
22.33HPRD
Link-
2647PhosphothreonineDFTLTQTAD
CCCCCCCCC
22.33Phosphositeplus
Link-
2647PhosphothreonineDFTLTQTAD
CCCCCCCCC
22.33SysPTM
Link-
2647Phosphothreonine (DNA-PK;DNA-PK)DFTLTQTAD
CCCCCCCCC
22.33PhosphoELM
Link-
2647Phosphothreonine (PRKDC)DFTLTQTAD
CCCCCCCCC
22.33HPRD
Link-
2647Phosphothreonine; by autocatalysis.DFTLTQTAD
CCCCCCCCC
22.33UniProtKB
Link-
2649PhosphothreonineTLTQTADGR
CCCCCCCCC
22.83HPRD
Link-
2649PhosphothreonineTLTQTADGR
CCCCCCCCC
22.83PhosphoELM
Link-
2649Phosphothreonine.TLTQTADGR
CCCCCCCCC
22.83UniProtKB
Link-
2671PhosphothreonineLVDHTSPSS
HHHCCCCCC
37.56HPRD
Link-
2671PhosphothreonineLVDHTSPSS
HHHCCCCCC
37.56PhosphoELM
Link-
2671Phosphothreonine.LVDHTSPSS
HHHCCCCCC
37.56UniProtKB
Link-
2672PhosphoserineVDHTSPSSD
HHCCCCCCH
21.26HPRD
Link-
2672PhosphoserineVDHTSPSSD
HHCCCCCCH
21.26PhosphoELM
Link-
2672PhosphoserineVDHTSPSSD
HHCCCCCCH
21.26Phosphositeplus
Link-
2672Phosphoserine.VDHTSPSSD
HHCCCCCCH
21.26UniProtKB
Link-
2674PhosphoserineHTSPSSDSL
CCCCCCHHH
46.69HPRD
Link-
2674PhosphoserineHTSPSSDSL
CCCCCCHHH
46.69PhosphoELM
Link-
2674PhosphoserineHTSPSSDSL
CCCCCCHHH
46.69Phosphositeplus
Link-
2675PhosphoserineTSPSSDSLL
CCCCCHHHH
34.30HPRD
Link-
2675PhosphoserineTSPSSDSLL
CCCCCHHHH
34.30PhosphoELM
Link-
2675PhosphoserineTSPSSDSLL
CCCCCHHHH
34.30SysPTM
Link-
2677PhosphoserinePSSDSLLFA
CCCHHHHHH
28.99HPRD
Link-
2677PhosphoserinePSSDSLLFA
CCCHHHHHH
28.99PhosphoELM
Link-
2677PhosphoserinePSSDSLLFA
CCCHHHHHH
28.99SysPTM
Link-
2683Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LFAHKRSER
HHHHHHHHH
54.94Phosphositeplus
Link-
2694Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RAPLKSVGP
HCCCCCCCC
41.87Phosphositeplus
Link-
2699noneSVGPDFGKK
CCCCCCCCC
60.03HPRD
Link-
2702Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PDFGKKRLG
CCCCCCCCC
34.41Phosphositeplus
Link-
2702N6-acetyllysinePDFGKKRLG
CCCCCCCCC
34.41HPRD
Link-
2702N6-acetyllysinePDFGKKRLG
CCCCCCCCC
34.41Phosphositeplus
Link-
2713noneGDEVDNKVK
CCHHCCHHC
47.38HPRD
Link-
2715Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVDNKVKGA
HHCCHHCCC
40.64Phosphositeplus
Link-
2738Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RDQEKLSLM
HHHHHHHHH
37.43Phosphositeplus
Link-
2743PhosphotyrosineLSLMYARKG
HHHHHHHHC
14.46HPRD
Link-
2743PhosphotyrosineLSLMYARKG
HHHHHHHHC
14.46PhosphoELM
Link-
2743PhosphotyrosineLSLMYARKG
HHHHHHHHC
14.46Phosphositeplus
Link-
2743Phosphotyrosine.LSLMYARKG
HHHHHHHHC
14.46UniProtKB
Link-
2764Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELKMKQDAQ
HHHHCCCCE
43.36Phosphositeplus
Link-
2786Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DIQIKHSSL
CEEEEHHHH
22.51Phosphositeplus
Link-
2789PhosphoserineIKHSSLITP
EEHHHHHHH
24.42HPRD
Link-
2789PhosphoserineIKHSSLITP
EEHHHHHHH
24.42PhosphoELM
Link-
2792PhosphothreonineSSLITPLQA
HHHHHHHHH
24.20HPRD
Link-
2792PhosphothreonineSSLITPLQA
HHHHHHHHH
24.20PhosphoELM
Link-
2806Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PIIAKQLFS
CHHHHHHHH
36.81Phosphositeplus
Link-
2829Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLSEKNNIT
CCHHHHHHH
52.50Phosphositeplus
Link-
2835Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NITQKLLQD
HHHHHHHHH
42.38Phosphositeplus
Link-
2908Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELPAKRVRG
CCCHHHHCC
49.87Phosphositeplus
Link-
2928Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VELAKLYRS
HHHHHHHHH
59.69Phosphositeplus
Link-
2950Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EIGTKQITQ
CCCCHHHHH
34.19Phosphositeplus
Link-
2970Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SEAAKQYDE
HHHHHHHHH
57.34Phosphositeplus
Link-
2978Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EALNKQDWV
HHCCCCCCC
50.95Phosphositeplus
Link-
3050Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RSKLKLLLQ
HHHHHHHHC
40.60Phosphositeplus
Link-
3067Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TFIDKAMHG
HHHHHHHHH
42.67Phosphositeplus
Link-
3158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QVPLKRLLN
HHHHHHHHH
34.62Phosphositeplus
Link-
3172Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YPDAKMDPM
CCCCCCCHH
51.74Phosphositeplus
Link-
3187S-nitrosocysteineITNRCFFLS
HHHHHHHHH
2.83dbSNO
Link-
3192Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FFLSKIEEK
HHHHHHHHH
57.17Phosphositeplus
Link-
3196Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KIEEKLTPL
HHHHHHCCC
44.89Phosphositeplus
Link-
3205PhosphoserinePEDNSMNVD
CCCCCCCCC
24.85HPRD
Link-
3205PhosphoserinePEDNSMNVD
CCCCCCCCC
24.85HPRD
Link-
3205PhosphoserinePEDNSMNVD
CCCCCCCCC
24.85PhosphoELM
Link-
3205PhosphoserinePEDNSMNVD
CCCCCCCCC
24.85Phosphositeplus
Link-
3205PhosphoserinePEDNSMNVD
CCCCCCCCC
24.85SysPTM
Link-
3205Phosphoserine (PRKDC)PEDNSMNVD
CCCCCCCCC
24.85HPRD
Link-
3205Phosphoserine.PEDNSMNVD
CCCCCCCCC
24.85UniProtKB
Link-
3211noneNVDQDGDPS
CCCHHCCCC
60.02HPRD
Link-
3233PhosphoserineSLIRSCKFS
HHHHCCCHH
18.05HPRD
Link-
3233PhosphoserineSLIRSCKFS
HHHHCCCHH
18.05Phosphositeplus
Link-
3241N6-acetyllysineSMKMKMIDS
HHHHHHHHH
27.47HPRD
Link-
3241N6-acetyllysineSMKMKMIDS
HHHHHHHHH
27.47Phosphositeplus
Link-
3241N6-acetyllysine.SMKMKMIDS
HHHHHHHHH
27.47UniProtKB
Link-
3248Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DSARKQNNF
HHHHHCCCH
58.03Phosphositeplus
Link-
3257Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLAMKLLKE
HHHHHHHHH
45.09Phosphositeplus
Link-
3260N6-acetyllysineMKLLKELHK
HHHHHHHHH
69.53HPRD
Link-
3260N6-acetyllysineMKLLKELHK
HHHHHHHHH
69.53Phosphositeplus
Link-
3260N6-acetyllysine.MKLLKELHK
HHHHHHHHH
69.53UniProtKB
Link-
3264Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KELHKESKT
HHHHHHHHC
76.06Phosphositeplus
Link-
3318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SYLSKNILA
HHHHHHHHH
45.47Phosphositeplus
Link-
3347S-nitrosocysteineSEPACLAEI
CCCCHHHHH
5.60dbSNO
Link-
3365PhosphoserineELSGSSSED
HHHHHCCCC
27.58HPRD
Link-
3372Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDSEKVIAG
CCHHHHHHH
42.78Phosphositeplus
Link-
3372N6-methyllysineEDSEKVIAG
CCHHHHHHH
42.78Phosphositeplus
Link-
3426Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QQLRKEEEN
HHHHHHCCC
77.42Phosphositeplus
Link-
3449Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVVEKMLKA
HHHHHHHHH
37.61Phosphositeplus
Link-
3455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKALKLNSN
HHHHCCCCH
50.94Phosphositeplus
Link-
3552Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GHKNKEFVA
HHCCCHHHH
58.28Phosphositeplus
Link-
3608N6-acetyllysineKNIEKMYER
HHHHHHHHH
42.88HPRD
Link-
3608N6-acetyllysineKNIEKMYER
HHHHHHHHH
42.88Phosphositeplus
Link-
3608N6-acetyllysine.KNIEKMYER
HHHHHHHHH
42.88UniProtKB
Link-
3621Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGDPKAPGL
HHHHHCCCH
72.46Phosphositeplus
Link-
3621N6-acetyllysineLGDPKAPGL
HHHHHCCCH
72.46HPRD
Link-
3621N6-acetyllysineLGDPKAPGL
HHHHHCCCH
72.46Phosphositeplus
Link-
3621N6-acetyllysine.LGDPKAPGL
HHHHHCCCH
72.46UniProtKB
Link-
3638Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QTFGKEFDK
HHHHHHHHH
51.52Phosphositeplus
Link-
3638N6-acetyllysineQTFGKEFDK
HHHHHHHHH
51.52HPRD
Link-
3638N6-acetyllysineQTFGKEFDK
HHHHHHHHH
51.52Phosphositeplus
Link-
3638N6-acetyllysine.QTFGKEFDK
HHHHHHHHH
51.52UniProtKB
Link-
3642N6-acetyllysineKEFDKHFGK
HHHHHHHCC
46.27HPRD
Link-
3642N6-acetyllysineKEFDKHFGK
HHHHHHHCC
46.27Phosphositeplus
Link-
3642N6-acetyllysine.KEFDKHFGK
HHHHHHHCC
46.27UniProtKB
Link-
3657PhosphoserineRMKLSDFND
HHHHHHHHH
34.34Phosphositeplus
Link-
3663PhosphothreonineFNDITNMLL
HHHHHHHHH
19.89Phosphositeplus
Link-
3669Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MLLLKMNKD
HHHHHHHHH
40.16Phosphositeplus
Link-
3710Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DGRGKPLPE
CCCCCCCCC
41.86Phosphositeplus
Link-
3753Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PFLVKGGED
EEEEECCCC
64.44Phosphositeplus
Link-
3825Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SQEEKAAYL
HHHHHHHCC
37.25Phosphositeplus
Link-
3828PhosphotyrosineEKAAYLSDP
HHHHCCCCC
16.17Phosphositeplus
Link-
3840Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PCEYKDWLT
HHHHHHHHH
21.82Phosphositeplus
Link-
3845Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DWLTKMSGK
HHHHHHHHC
28.97Phosphositeplus
Link-
3860Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MLMYKGANR
HHHHHHHCC
37.27Phosphositeplus
Link-
3884Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ADLLKRAFV
HHHHHHHHH
49.31Phosphositeplus
Link-
3950PhosphothreonineFGSATQFLP
HCCCCCCCC
22.88Phosphositeplus
Link-
3982PhosphoserineGLMYSIMVH
HHHHHHHHH
7.11HPRD
Link-
4007Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVFVKEPSF
HHHHHCCCC
53.06Phosphositeplus
Link-
4019Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NFEQKMLKK
CCCCCCCCC
38.72Phosphositeplus
Link-
4023Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KMLKKGGSW
CCCCCCCCH
65.62Phosphositeplus
Link-
4026PhosphoserineKKGGSWIQE
CCCCCHHHH
29.67HPRD
Link-
4026PhosphoserineKKGGSWIQE
CCCCCHHHH
29.67PhosphoELM
Link-
4026PhosphoserineKKGGSWIQE
CCCCCHHHH
29.67Phosphositeplus
Link-
4026PhosphoserineKKGGSWIQE
CCCCCHHHH
29.67SysPTM
Link-
4026Phosphoserine.KKGGSWIQE
CCCCCHHHH
29.67UniProtKB
Link-
4036Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NVAEKNWYP
CCCCCCCCH
42.94Phosphositeplus
Link-
4045S-nitrosocysteineRQKICYAKR
HHHHHHHHH
3.30dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ABL1_HUMANphysical interactionMINT-18494MINT9312071
NFKB1_HUMANphysical interactionMINT-48684MINT14743216
1433B_HUMANphysical interactionMINT-50940MINT15324660
1433G_HUMANphysical interactionMINT-50679MINT15324660
ILF2_HUMANphysical interactionMINT-15382MINT9442054
ILF2_HUMANphysical interactionMINT-15383MINT9442054
ILF3_HUMANphysical interactionMINT-15144MINT9442054
TRADD_HUMANphysical interactionMINT-49494MINT14743216
RIPK3_HUMANphysical interactionMINT-49149MINT14743216
RFA2_HUMANphysical interactionDIP:40057EDIP10064605
GCR_HUMANin vitroHPRD:02941HPRD9038175
HS90A_HUMANin vitroHPRD:02941HPRD2507541
HSF1_HUMANin vitroHPRD:02941HPRD9325337
HXC4_HUMANin vitro
in vivo
HPRD:02941HPRD11279128
KPCD_HUMANin vitroHPRD:02941HPRD9774685
PARP1_HUMANin vivoHPRD:02941HPRD9398855
HMGB1_HUMANin vitroHPRD:02941HPRD9722660
PCNA_HUMANin vitroHPRD:02941HPRD12171929
KU70_HUMANin vitro
in vivo
HPRD:02941HPRD11279128
10446239
9312071
HMGB2_HUMANin vitroHPRD:02941HPRD9722660
LYN_HUMANin vitroHPRD:02941HPRD9748231
JUN_HUMANin vitroHPRD:02941HPRD8464713
P53_HUMANin vitro
in vivo
HPRD:02941HPRD10470151
9765199
11551930
11709713
10673501
10747897
11883897
10951572
RFA1_HUMANin vitroHPRD:02941HPRD10064605
RFA2_HUMANin vitroHPRD:02941HPRD11731442
10064605
9295339
ABL1_HUMANin vitroHPRD:02941HPRD9312071
PRKDC_HUMANin vitro
in vivo
HPRD:02941HPRD10823961
12186630
SRF_HUMANin vitro
in vivo
HPRD:02941HPRD8407951
IKKA_HUMANin vivoHPRD:02941HPRD9632806
ATRIP_HUMANin vivoHPRD:02941HPRD15758953
DNL4_HUMANin vitroHPRD:02941HPRD15194694
CIB1_HUMANin vitro
in vivo
HPRD:02941HPRD9372844
15190070
XPA_HUMANin vitroHPRD:02941HPRD16540648
PARP2_HUMANENSP00000313420STRING
P53_HUMANENSP00000313420STRING
LYN_HUMANENSP00000313420STRING
WRN_HUMANENSP00000313420STRING
RAG1_HUMANENSP00000313420STRING
RAG2_HUMANENSP00000313420STRING
CASP3_HUMANENSP00000313420STRING
ILF3_HUMANENSP00000313420STRING
ATRIP_HUMANENSP00000313420STRING
KU86_HUMANENSP00000313420STRING
KU86_HUMANENSP00000313420STRING
KU86_HUMANENSP00000313420STRING
CIB1_HUMANENSP00000313420STRING
XRCC4_HUMANENSP00000313420STRING
KU70_HUMANENSP00000313420STRING
KU70_HUMANENSP00000313420STRING
TOP1_HUMANENSP00000313420STRING
ILF2_HUMANENSP00000313420STRING
- top -

Disease Reference
Kegg disease
OMIM disease
615966Immunodeficiency 26 with or without neurologic abnormalities (IMD26)
Drug Reference
DrugBank
DB00201Caffeine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-117; LYS-254; LYS-828;LYS-832; LYS-1057; LYS-1209; LYS-1970; LYS-2259; LYS-3241; LYS-3260;LYS-3608; LYS-3621; LYS-3638 AND LYS-3642, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Identification of in vitro and in vivo phosphorylation sites in thecatalytic subunit of the DNA-dependent protein kinase.";
Douglas P., Sapkota G.P., Morrice N., Yu Y., Goodarzi A.A., Merkle D.,Meek K., Alessi D.R., Lees-Miller S.P.;
Biochem. J. 368:243-251(2002).
Cited for: PHOSPHORYLATION AT THR-2609; SER-2612; THR-2638 AND THR-2647.
"Autophosphorylation of the DNA-dependent protein kinase catalyticsubunit is required for rejoining of DNA double-strand breaks.";
Chan D.W., Chen B.P., Prithivirajsingh S., Kurimasa A., Story M.D.,Qin J., Chen D.J.;
Genes Dev. 16:2333-2338(2002).
Cited for: MASS SPECTROMETRY, PHOSPHORYLATION AT THR-2609, MUTAGENESIS OFTHR-2609, AND SUBCELLULAR LOCATION.
"Large-scale characterization of HeLa cell nuclear phosphoproteins.";
Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J.,Li J., Cohn M.A., Cantley L.C., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3205, AND MASSSPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3205, AND MASSSPECTROMETRY.
"Phosphoproteome analysis of the human mitotic spindle.";
Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.;
Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2603; THR-2609;SER-2612; THR-2638; THR-2647 AND THR-2649, AND MASS SPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-2743, AND MASSSPECTROMETRY.
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2612; THR-2638 ANDTHR-2647, AND MASS SPECTROMETRY.
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1052; SER-2117; SER-3205AND SER-4026, AND MASS SPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893; SER-3205 ANDSER-4026, AND MASS SPECTROMETRY.
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511; SER-841; SER-893;SER-2612; THR-2671; SER-2672; SER-3205 AND SER-4026, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3205, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures