Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Profilin-1  

UniProtKB / Swiss-Prot ID :  PROF1_BOVIN

Gene Name (Synonyms) : 
PFN1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cytoplasm, cytoskeleton. 

Protein Function :  Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR (By similarity). 

Protein Sequence MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQK...
Predicted Secondary Structure CCHHHHHHHHHHCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGWNA
---CCHHHH
31.54UniProtKB
Link
138PhosphoserineHLRRSQY
HHHHCCC
27.65Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The amino acid sequence of profilin from calf spleen.";
Nystroem L.-E., Lindberg U., Kendrick-Jones J., Jakes R.;
FEBS Lett. 101:161-165(1979).
Cited for: PROTEIN SEQUENCE OF 2-140, AND ACETYLATION AT ALA-2.
"The primary structure of human platelet profilin: reinvestigation ofthe calf spleen profilin sequence.";
Ampe C., Markey F., Lindberg U., Vandekerckhove J.;
FEBS Lett. 228:17-21(1988).
Cited for: SEQUENCE REVISION.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures