Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Profilin-2  

UniProtKB / Swiss-Prot ID :  PROF2_HUMAN

Gene Name (Synonyms) : 
PFN2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytoskeleton. 

Protein Function :  Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. 

Protein Sequence MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK...
Predicted Secondary Structure CCHHHHHHHHHHHCCCCCEEEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCCEECCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
6PhosphoserineAGWQSYVDN
CHHHHHHHH
22.18HPRD
Link
6PhosphoserineAGWQSYVDN
CHHHHHHHH
22.18Phosphositeplus
Link
7PhosphotyrosineGWQSYVDNL
HHHHHHHHH
9.20HPRD
Link
7PhosphotyrosineGWQSYVDNL
HHHHHHHHH
9.20Phosphositeplus
Link
91Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DIRTKSQGG
EEEEECCCC
30.82Phosphositeplus
Link
99PhosphotyrosineGEPTYNVAV
CCCCCCEEE
20.53HPRD
Link
99PhosphotyrosineGEPTYNVAV
CCCCCCEEE
20.53PhosphoELM
Link
99PhosphotyrosineGEPTYNVAV
CCCCCCEEE
20.53Phosphositeplus
Link
99Phosphotyrosine.GEPTYNVAV
CCCCCCEEE
20.53UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SGTA_HUMANphysical interactionMINT-63165MINT16169070
HD_HUMANphysical interactionMINT-3978554MINT15383276
FLT3L_HUMANphysical interactionMINT-63799MINT16169070
ACTG_HUMANphysical interactionMINT-63992MINT16169070
RED_HUMANphysical interactionMINT-64116MINT16169070
GOGB1_HUMANphysical interactionMINT-64179MINT16169070
Q5TZB9_HUMANphysical interactionMINT-64533MINT16169070
DDX11_HUMANphysical interactionMINT-65144MINT16169070
ACTB_HUMANin vitro
in vivo
HPRD:01451HPRD10600384
HD_HUMANyeast 2-hybridHPRD:01451HPRD15383276
PROF2_HUMANin vitroHPRD:01451HPRD10600384
TERF1_HUMANyeast 2-hybridHPRD:01451HPRD16169070
SEPT5_HUMANyeast 2-hybridHPRD:01451HPRD16169070
SGTA_HUMANyeast 2-hybridHPRD:01451HPRD16169070
RS10_HUMANyeast 2-hybridHPRD:01451HPRD16169070
UPAR_HUMANyeast 2-hybridHPRD:01451HPRD16169070
RPGP1_HUMANyeast 2-hybridHPRD:01451HPRD16169070
PTPRS_HUMANyeast 2-hybridHPRD:01451HPRD16169070
CC113_HUMANyeast 2-hybridHPRD:01451HPRD16169070
RN146_HUMANyeast 2-hybridHPRD:01451HPRD16169070
WDR33_HUMANyeast 2-hybridHPRD:01451HPRD16169070
CP024_HUMANyeast 2-hybridHPRD:01451HPRD16169070
VASP_HUMANENSP00000239940STRING
ACTG_HUMANENSP00000239940STRING
ACTB_HUMANENSP00000239940STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-99, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures