Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Parvalbumin, muscle  

UniProtKB / Swiss-Prot ID :  PRVM_CHICK

Gene Name (Synonyms) :  -
 

Species :  Gallus gallus (Chicken). 

Subcellular Localization :   

Protein Function :  In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity). 

Protein Sequence AMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIEEEELKFVLKGF...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----AMTDV
----CCCCC
22.38UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Parvalbumin isoforms in chicken muscle and thymus. Amino acidsequence analysis of muscle parvalbumin by tandem mass spectrometry.";
Kuster T., Staudenmann W., Hughes G.J., Heizmann C.W.;
Biochemistry 30:8812-8816(1991).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures