Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Chloroperoxidase  

UniProtKB / Swiss-Prot ID :  PRXC_CALFU

Gene Name (Synonyms) : 
CPO  

Species :  Caldariomyces fumago (Leptoxyphium fumago). 

Subcellular Localization :   

Protein Function :  Catalyzes peroxidative halogenations involved in the biosynthesis of clardariomycin (2,2-dichloro-1,3-cyclo- pentenedione). The enzyme also has potent catalase activity and in the absence of halide ion, acts as a peroxidase similar to plant peroxidases. 

Protein Sequence MFSKVLPFVGAVAALPHSVRQEPGSGIGYPYDNNTLPYVAPGPTDSRAPCPALNALANHGYIPHDGRAIS...
Predicted Secondary Structure CCHHHHHHHHHHHHCCHHHHHCCCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
21Pyrrolidone carboxylic acid.HSVRQEPGS
HHHHHCCCC
60.11UniProtKB
Link
33N-linked (GlcNAc...).YPYDNNTLP
CCCCCCCCC
37.23UniProtKB
Link
114N-linked (GlcNAc...).DSLVNLTLL
CCEEEEEEC
32.38UniProtKB
Link
237N-linked (GlcNAc...).YWFTNESFP
EEECCCCCC
33.18UniProtKB
Link
259O-linked (Man).IEFVTSASS
EEEEECCCC
24.72UniProtKB
Link
260O-linked (Man).EFVTSASSA
EEEECCCCE
22.35UniProtKB
Link
262O-linked (Man).VTSASSAVL
EECCCCEEE
20.71UniProtKB
Link
263O-linked (Man).TSASSAVLA
ECCCCEEEE
23.32UniProtKB
Link
271O-linked (Man).AASVTSTPS
EEECCCCCC
25.12UniProtKB
Link
272O-linked (Man).ASVTSTPSS
EECCCCCCC
35.84UniProtKB
Link
273O-linked (Man).SVTSTPSSL
ECCCCCCCC
20.16UniProtKB
Link
296O-linked (Man...).SFASTMTPF
EHHHHHCCE
22.95UniProtKB
Link
304O-linked (Man...).FLLATNAPY
EEEECCCCC
31.70UniProtKB
Link
314O-linked (Man...).AQDPTLGPN
CCCCCCCCC
53.27UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures