Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Proteasome subunit alpha type-2  

UniProtKB / Swiss-Prot ID :  PSA2_MOUSE

Gene Name (Synonyms) : 
Psma2, Lmpc3  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Nucleus. 

Protein Function :  The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation. 

Protein Sequence MAKRGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITK...
Predicted Secondary Structure CCCCCCCCCCEEEECCCCEEEEHHHHHHHHCCCEEEEEEECCEEEEEEECCCCCCCCCCCCCCCEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
6PhosphotyrosineAKRGYSFSL
CCCCCCCCC
15.58Phosphositeplus
Link
7PhosphoserineKRGYSFSLT
CCCCCCCCE
15.93Phosphositeplus
Link
57PhosphotyrosineKSILYDERS
CCCCCCCCC
17.68Phosphositeplus
Link
57PhosphotyrosineKSILYDERS
CCCCCCCCC
17.68SysPTM
Link
76PhosphotyrosineIGLVYSGMG
EEEEEECCH
12.44Phosphositeplus
Link
76PhosphotyrosineIGLVYSGMG
EEEEEECCH
12.44SysPTM
Link
76Phosphotyrosine.IGLVYSGMG
EEEEEECCH
12.44UniProtKB
Link
98PhosphotyrosineAQQYYLVYQ
HHHHHHHCC
5.83Phosphositeplus
Link
98PhosphotyrosineAQQYYLVYQ
HHHHHHHCC
5.83SysPTM
Link
101PhosphotyrosineYYLVYQEPI
HHHHCCCCC
12.45Phosphositeplus
Link
101PhosphotyrosineYYLVYQEPI
HHHHCCCCC
12.45SysPTM
Link
198PhosphoserineTLKESFEGQ
HHHHHHHCC
27.32SysPTM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-76, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures