Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  26S proteasome non-ATPase regulatory subunit 5  

UniProtKB / Swiss-Prot ID :  PSMD5_HUMAN

Gene Name (Synonyms) : 
PSMD5, KIAA0072  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a PSMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5. 

Protein Sequence MAAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILER...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH...
Protein Variant
LocationDescription
21E -> G (in dbSNP:rs2297575). VAR_051556
72L -> H (in dbSNP:rs17282618). VAR_051557
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAQAL
---CCHHHH
14.31UniProtKB
Link-
147Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KAAIKSLSR
HHHHHHHHH
40.39Phosphositeplus
Link-
478PhosphotyrosineGNPNYLRLR
CCCCEEEEE
8.41Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PRS7_HUMANin vitroHPRD:05121HPRD10625621
PRS4_HUMANin vitroHPRD:05121HPRD10625621
PSA4_HUMANENSP00000210313STRING
PRS6B_HUMANENSP00000210313STRING
PSMD8_HUMANENSP00000210313STRING
PRS10_HUMANENSP00000210313STRING
PSA3_HUMANENSP00000210313STRING
PSME2_HUMANENSP00000210313STRING
PSD10_HUMANENSP00000210313STRING
PSD7_HUMANENSP00000210313STRING
PSA2_HUMANENSP00000210313STRING
PSB3_HUMANENSP00000210313STRING
PSB7_HUMANENSP00000210313STRING
PRS4_HUMANENSP00000210313STRING
PSA6_HUMANENSP00000210313STRING
PSD11_HUMANENSP00000210313STRING
PSMD9_HUMANENSP00000210313STRING
PSB1_HUMANENSP00000210313STRING
PSDE_HUMANENSP00000210313STRING
PSMD3_HUMANENSP00000210313STRING
PSB6_HUMANENSP00000210313STRING
PSA5_HUMANENSP00000210313STRING
PSB4_HUMANENSP00000210313STRING
PRS7_HUMANENSP00000210313STRING
PSMD6_HUMANENSP00000210313STRING
PRS6A_HUMANENSP00000210313STRING
PSMD1_HUMANENSP00000210313STRING
PSMD2_HUMANENSP00000210313STRING
PRS8_HUMANENSP00000210313STRING
PSD13_HUMANENSP00000210313STRING
PSMF1_HUMANENSP00000210313STRING
PSD12_HUMANENSP00000210313STRING
PSB5_HUMANENSP00000210313STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides.";
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.;
Nat. Biotechnol. 21:566-569(2003).
Cited for: PROTEIN SEQUENCE OF 2-10, AND ACETYLATION AT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures