Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Proteasome inhibitor PI31 subunit  

UniProtKB / Swiss-Prot ID :  PSMF1_BOVIN

Gene Name (Synonyms) : 
PSMF1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :   

Protein Function :  Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28 (By similarity). 

Protein Sequence MAGLEVLFASAAPAITCAQDALVCFLHWEVVTHGYYGLGAGDQPGPNDKKSELLPVEWNSNKDLYVLRYE...
Predicted Secondary Structure CCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures