Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Prostaglandin reductase 1  

UniProtKB / Swiss-Prot ID :  PTGR1_HUMAN

Gene Name (Synonyms) : 
PTGR1, LTB4DH  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4. 

Protein Sequence MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAK...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
27A -> S (in dbSNP:rs1053959). VAR_023111
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
16PhosphotyrosineHFVGYPTNS
11.11Phosphositeplus
Link
58Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AKRLKEGDT
64.78Phosphositeplus
Link
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QQVAKVVES
48.21Phosphositeplus
Link
178Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSDEKVAYL
36.84Phosphositeplus
Link
204Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EETLKKASP
54.43Phosphositeplus
Link
262PhosphotyrosineEIVIYQELR
5.76Phosphositeplus
Link
289N6-acetyllysineKDLLKWVLE
42.42Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures