Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Trifunctional purine biosynthetic protein adenosine-3  

UniProtKB / Swiss-Prot ID :  PUR2_HUMAN

Gene Name (Synonyms) : 
GART, PGFT, PRGS  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFV...
Predicted Secondary Structure CCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCEE...
Protein Variant
LocationDescription
21L -> F (in dbSNP:rs1804387). VAR_011817
421V -> I (in dbSNP:rs8788). VAR_011818
510D -> G (in dbSNP:rs35927582). VAR_051882
641P -> A (in dbSNP:rs34588874). VAR_051883
752D -> G (in dbSNP:rs8971). VAR_011819
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAARVL
---CCCEEE
18.45UniProtKB
Link-
66Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CKEKKIEFV
HHHCCCCEE
48.86Phosphositeplus
Link-
107Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LESSKRFAK
HHHCHHHHH
61.90Phosphositeplus
Link-
111Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KRFAKEFMD
HHHHHHHHH
49.09Phosphositeplus
Link-
121PhosphothreonineHGIPTAQWK
CCCCCCCCE
29.56HPRD
Link-
121PhosphothreonineHGIPTAQWK
CCCCCCCCE
29.56Phosphositeplus
Link-
156Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAAGKGVIV
CCCCEEEEE
45.32Phosphositeplus
Link-
219Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQDHKRLLE
HHHHHHHCC
53.70Phosphositeplus
Link-
251Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LLKIKDTVL
HHHHHHHHH
45.84Phosphositeplus
Link-
281Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IMLTKNGPK
EEEECCCEE
56.81Phosphositeplus
Link-
298S-nitrosocysteineGDPECQVIL
CCCCCEEEE
4.82dbSNO
Link-
348PhosphotyrosineYPGDYTKGV
CCCCCCCCC
19.10HPRD
Link-
348PhosphotyrosineYPGDYTKGV
CCCCCCCCC
19.10HPRD
Link-
348PhosphotyrosineYPGDYTKGV
CCCCCCCCC
19.10PhosphoELM
Link-
348PhosphotyrosineYPGDYTKGV
CCCCCCCCC
19.10Phosphositeplus
Link-
348Phosphotyrosine.YPGDYTKGV
CCCCCCCCC
19.10UniProtKB
Link-
350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GDYTKGVEI
CCCCCCCEE
55.52Phosphositeplus
Link-
350N6-acetyllysineGDYTKGVEI
CCCCCCCEE
55.52HPRD
Link-
350N6-acetyllysineGDYTKGVEI
CCCCCCCEE
55.52Phosphositeplus
Link-
350N6-acetyllysine.GDYTKGVEI
CCCCCCCEE
55.52UniProtKB
Link-
375Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GTALKNGKV
EEECCCCEE
62.28Phosphositeplus
Link-
378Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKNGKVVTH
CCCCEEEEC
42.81Phosphositeplus
Link-
404Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEEAKKGLA
HHHHHHHHH
51.13Phosphositeplus
Link-
411Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAAIKFEGA
HHHHCCCCC
32.41Phosphositeplus
Link-
438Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLTYKESGV
HHHHHHCCC
39.92Phosphositeplus
Link-
459Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QPLAKATSR
HHHHHHHCC
60.94Phosphositeplus
Link-
480Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LFDLKAAGF
EEEECCCCC
37.73Phosphositeplus
Link-
485Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AAGFKDPLL
CCCCCCCEE
58.48Phosphositeplus
Link-
697Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VLPEKLGVD
HCCCCCEEE
48.91Phosphositeplus
Link-
779Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RVKVKNLIE
EEEECCHHH
40.08Phosphositeplus
Link-
817PhosphothreonineLISGTGSNL
EEECCCCHH
30.55HPRD
Link
819PhosphoserineSGTGSNLQA
ECCCCHHHH
33.92HPRD
Link
827PhosphoserineALIDSTREP
HHHHCCCCC
23.52HPRD
Link
910Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KWNGKMLNI
HCCCCEEEE
36.68Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NEMO_HUMANphysical interactionMINT-48228MINT14743216
PUR2_HUMANin vitroHPRD:00716HPRD12450384
12755606
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00642Pemetrexed
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-350, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-348, AND MASSSPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-348, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures