Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Adenylosuccinate lyase  

UniProtKB / Swiss-Prot ID :  PUR8_HUMAN

Gene Name (Synonyms) : 
ADSL, AMPS  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLE...
Predicted Secondary Structure CCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC...
Protein Variant
LocationDescription
2A -> V (in ADSL deficiency; severe). VAR_016930
3A -> V (in ADSL deficiency; severe). VAR_017078
26M -> L (in ADSL deficiency; severe). VAR_016931
31S -> N (in dbSNP:rs5757921). VAR_037883
72I -> V (in ADSL deficiency; severe). VAR_007972
100P -> A (in ADSL deficiency; moderate). VAR_017079
114Y -> H (in ADSL deficiency; severe. Totalloss of activity).
141R -> W (in ADSL deficiency; severe). VAR_007973
147K -> M (in dbSNP:rs11089991). VAR_037884
190R -> Q (in ADSL deficiency; moderate;dbSNP:rs28941471).
194R -> C (in ADSL deficiency; severe). VAR_017081
246K -> E (in ADSL deficiency; moderate). VAR_007975
268D -> N (in ADSL deficiency; severe. Totalloss of activity).
303R -> C (in ADSL deficiency; mild). VAR_007976
311L -> V (in ADSL deficiency; severe). VAR_017083
318P -> L (in ADSL deficiency; severe). VAR_017084
364V -> M (in ADSL deficiency; severe). VAR_017085
374R -> W (in ADSL deficiency; severe). VAR_017086
395S -> R (in ADSL deficiency; severe). VAR_007977
396R -> C (in ADSL deficiency; severe). VAR_017087
396R -> H (in ADSL deficiency; severe). VAR_017088
422D -> Y (in ADSL deficiency; moderate). VAR_017089
423L -> V (in ADSL deficiency; moderate). VAR_017090
426R -> H (in ADSL deficiency; severe. Mostfrequent mutation).
430D -> N (in ADSL deficiency; mild). VAR_017091
438S -> P (in ADSL deficiency; severe). VAR_000680
447S -> P (in ADSL deficiency; severe). VAR_017092
450T -> S (in ADSL deficiency; moderate). VAR_016932
452R -> P (in ADSL deficiency; severe). VAR_017093
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAGGD
---CCCCCC
18.14UniProtKB
Link-
9PhosphoserineGDHGSPDSY
CCCCCCCCH
23.32HPRD
Link
9PhosphoserineGDHGSPDSY
CCCCCCCCH
23.32Phosphositeplus
Link
9Phosphoserine.GDHGSPDSY
CCCCCCCCH
23.32UniProtKB
Link
12PhosphoserineGSPDSYRSP
CCCCCHHHH
26.32HPRD
Link
12PhosphoserineGSPDSYRSP
CCCCCHHHH
26.32Phosphositeplus
Link
15PhosphoserineDSYRSPLAS
CCHHHHHHH
18.94HPRD
Link
15PhosphoserineDSYRSPLAS
CCHHHHHHH
18.94Phosphositeplus
Link
75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NIDFKMAAE
CCCHHHHHH
24.71Phosphositeplus
Link
147N6-acetyllysineADFAKERAS
HHHHHHHCC
47.96HPRD
Link
147N6-acetyllysineADFAKERAS
HHHHHHHCC
47.96Phosphositeplus
Link
147N6-acetyllysine.ADFAKERAS
HHHHHHHCC
47.96UniProtKB
Link
170Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TTVGKRCCL
HHHHHHHHH
37.62Phosphositeplus
Link
229Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MVTEKAGFK
HHHHHHCCC
44.43Phosphositeplus
Link
276Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LANLKEMEE
HHCCCCEEE
55.62Phosphositeplus
Link
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EPFEKQQIG
EECCCCCCC
48.13Phosphositeplus
Link-
295N6-acetyllysineAMPYKRNPM
CCCCCCCCH
39.57HPRD
Link
295N6-acetyllysineAMPYKRNPM
CCCCCCCCH
39.57Phosphositeplus
Link
295N6-acetyllysine.AMPYKRNPM
CCCCCCCCH
39.57UniProtKB
Link
415Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ASVVKQEGG
HHHHHHHHH
40.24Phosphositeplus
Link
434PhosphoserineDAYFSPIHS
HHHHCHHHH
15.40Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
5NT1A_HUMANENSP00000216194STRING
PUR9_HUMANENSP00000216194STRING
5NT3_HUMANENSP00000216194STRING
NT5C_HUMANENSP00000216194STRING
AMPD3_HUMANENSP00000216194STRING
AMPD2_HUMANENSP00000216194STRING
5NTD_HUMANENSP00000216194STRING
PUR1_HUMANENSP00000216194STRING
PUR6_HUMANENSP00000216194STRING
KAD7_HUMANENSP00000216194STRING
ADK_HUMANENSP00000216194STRING
DCK_HUMANENSP00000216194STRING
DCK_HUMANENSP00000216194STRING
DCK_HUMANENSP00000216194STRING
ENTP3_HUMANENSP00000216194STRING
CANT1_HUMANENSP00000216194STRING
5NTC_HUMANENSP00000216194STRING
ENTP8_HUMANENSP00000216194STRING
ENTP8_HUMANENSP00000216194STRING
KAD5_HUMANENSP00000216194STRING
5NT1B_HUMANENSP00000216194STRING
ARLY_HUMANENSP00000216194STRING
- top -

Disease Reference
Kegg disease
OMIM disease
103050Adenylosuccinase deficiency (ADSLD)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-9, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-147 AND LYS-295, AND MASSSPECTROMETRY.
Phosphorylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-9, AND MASS SPECTROMETRY.
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures