Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glycogen phosphorylase, brain form  

UniProtKB / Swiss-Prot ID :  PYGB_HUMAN

Gene Name (Synonyms) : 
PYGB  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. 

Protein Sequence MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTVRDHLVGRWIR...
Predicted Secondary Structure CCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
303A -> S (in dbSNP:rs2228976). VAR_034428
502D -> N (in dbSNP:rs2227891). VAR_020212
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAKPLT
---CCCCCC
23.36UniProtKB
Link-
6PhosphothreonineAKPLTDSEK
CCCCCCHHH
46.11HPRD
Link-
15PhosphoserineRKQISVRGL
HHHHCCCCC
11.85HPRD
Link-
15PhosphoserineRKQISVRGL
HHHHCCCCC
11.85Phosphositeplus
Link-
15PhosphoserineRKQISVRGL
HHHHCCCCC
11.85SysPTM
Link-
15Phosphoserine (PHK_group)RKQISVRGL
HHHHCCCCC
11.85PhosphoELM
Link-
15Phosphoserine; by PHK; in formphosphorylase A.RKQISVRGL
HHHHCCCCC
11.85UniProtKB
Link-
76PhosphotyrosineQQHYYERDP
HHHHHHCCC
11.45HPRD
Link-
76PhosphotyrosineQQHYYERDP
HHHHHHCCC
11.45PhosphoELM
Link-
76PhosphotyrosineQQHYYERDP
HHHHHHCCC
11.45Phosphositeplus
Link-
76Phosphotyrosine.QQHYYERDP
HHHHHHCCC
11.45UniProtKB
Link-
162PhosphotyrosineYGIRYEFGI
EEEECCCCE
17.43HPRD
Link-
186PhosphotyrosineDWLRYGNPW
HHHHCCCCC
21.05Phosphositeplus
Link-
197PhosphotyrosineARPEYMLPV
ECCCEEEEE
13.46HPRD
Link-
197PhosphotyrosineARPEYMLPV
ECCCEEEEE
13.46PhosphoELM
Link-
197PhosphotyrosineARPEYMLPV
ECCCEEEEE
13.46Phosphositeplus
Link-
197Phosphotyrosine.ARPEYMLPV
ECCCEEEEE
13.46UniProtKB
Link-
235Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPGYKNNTV
CCCCCCCCE
50.03Phosphositeplus
Link-
248Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LWSAKAPND
EEEECCCCC
59.88Phosphositeplus
Link-
263PhosphotyrosineNVGDYIEAV
CCCCHHHHH
8.50Phosphositeplus
Link-
290Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FFEGKELRL
CCCHHHHHH
46.51Phosphositeplus
Link-
316N6-acetyllysineFKSSKFGCR
HHHCCCCCC
53.52HPRD
Link-
364Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDWDKAWEI
CCHHHHHHH
51.66Phosphositeplus
Link-
371Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EITKKTCAY
HHHCEEEEE
39.94Phosphositeplus
Link-
465Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SEIVKQSVF
HHHHHHHHH
42.38Phosphositeplus
Link-
470Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QSVFKDFYE
HHHHHHHHH
44.78Phosphositeplus
Link-
473PhosphotyrosineFKDFYELEP
HHHHHHHCC
29.73Phosphositeplus
Link-
473Phosphotyrosine.FKDFYELEP
HHHHHHHCC
29.73UniProtKB
Link-
520Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSQLKKLLP
HHHHHHHHH
33.47Phosphositeplus
Link-
521Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SQLKKLLPL
HHHHHHHHH
64.94Phosphositeplus
Link-
562PhosphoserineINPSSMFDV
ECCCEEEEE
25.40HPRD
Link-
562PhosphoserineINPSSMFDV
ECCCEEEEE
25.40Phosphositeplus
Link-
656Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLAEKVIPA
HHHHHHHHH
39.60Phosphositeplus
Link-
740Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LPELKQAVD
CHHHHHHHH
34.25Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ACTN1_HUMANin vivoHPRD:00720HPRD12211109
GYS2_HUMANENSP00000216962STRING
GLGB_HUMANENSP00000216962STRING
AGM1_HUMANENSP00000216962STRING
AMYP_HUMANENSP00000216962STRING
GDE_HUMANENSP00000216962STRING
GYS1_HUMANENSP00000216962STRING
UGPA_HUMANENSP00000216962STRING
ENPP3_HUMANENSP00000216962STRING
ENPP1_HUMANENSP00000216962STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells.";
Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.;
J. Proteome Res. 8:3852-3861(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-197 AND TYR-473, ANDMASS SPECTROMETRY.
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15, AND MASSSPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15, AND MASSSPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-76 AND TYR-197, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures