Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glycogen phosphorylase, liver form  

UniProtKB / Swiss-Prot ID :  PYGL_HUMAN

Gene Name (Synonyms) : 
PYGL  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. 

Protein Sequence MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIR...
Predicted Secondary Structure CCCCCCCHHHHHHEEEECCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
222V -> I (in dbSNP:rs946616). VAR_007907
231V -> E (in dbSNP:rs1042195). VAR_013095
339N -> S (in GSD6). VAR_007908
377N -> K (in GSD6). VAR_007909
425R -> P (in dbSNP:rs2228499). VAR_034425
698V -> G (in dbSNP:rs35831273). VAR_034426
715R -> S (in dbSNP:rs1042210). VAR_013096
806I -> L (in dbSNP:rs34313873). VAR_034427
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAKPLT
---CCCCCC
23.36UniProtKB
Link-
15PhosphoserineRRQISIRGI
HHHEEEECC
9.63HPRD
Link-
15PhosphoserineRRQISIRGI
HHHEEEECC
9.63PhosphoELM
Link-
15PhosphoserineRRQISIRGI
HHHEEEECC
9.63Phosphositeplus
Link-
15PhosphoserineRRQISIRGI
HHHEEEECC
9.63SysPTM
Link-
15Phosphoserine; by PHK; in formphosphorylase A.RRQISIRGI
HHHEEEECC
9.63UniProtKB
Link-
29Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VAELKKSFN
HHHHHHHHH
37.57Phosphositeplus
Link
75PhosphotyrosineTQQHYYDKC
HHHHHHHCC
14.71HPRD
Link
75PhosphotyrosineTQQHYYDKC
HHHHHHHCC
14.71PhosphoELM
Link
75PhosphotyrosineTQQHYYDKC
HHHHHHHCC
14.71Phosphositeplus
Link
75Phosphotyrosine.TQQHYYDKC
HHHHHHHCC
14.71UniProtKB
Link
76PhosphotyrosineQQHYYDKCP
HHHHHHCCC
13.55HPRD
Link
76PhosphotyrosineQQHYYDKCP
HHHHHHCCC
13.55PhosphoELM
Link
76PhosphotyrosineQQHYYDKCP
HHHHHHCCC
13.55Phosphositeplus
Link
76Phosphotyrosine.QQHYYDKCP
HHHHHHCCC
13.55UniProtKB
Link
170Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IFNQKIRDG
EEEEEEECC
40.59Phosphositeplus
Link
186PhosphotyrosineDWLRYGNPW
HHHHCCCCE
21.05Phosphositeplus
Link
192Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NPWEKSRPE
CCEEEECCC
48.15Phosphositeplus
Link
206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HFYGKVEHT
EECEEEEEC
32.82Phosphositeplus
Link
290Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FFEGKELRL
CCCHHHHHH
46.51Phosphositeplus
Link
359Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDIEKLPWS
HHHHCCCHH
61.25Phosphositeplus
Link
364Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LPWSKAWEL
CCHHHHHHH
54.36Phosphositeplus
Link
371Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELTQKTFAY
HHHCEEEEE
40.13Phosphositeplus
Link
395Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLVEKLLPR
HHHHHHHHH
48.09Phosphositeplus
Link
410Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EINQKHLDR
HHHHHHHHH
41.46Phosphositeplus
Link
421Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALFPKDVDR
HHCCCCHHH
64.15Phosphositeplus
Link
438Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEGSKRINM
CCCCCCEEE
69.06Phosphositeplus
Link
465Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SDIVKTKVF
HHHHHHHHH
42.85Phosphositeplus
Link
470Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TKVFKDFSE
HHHHHHHHH
61.93Phosphositeplus
Link
470N6-acetyllysineTKVFKDFSE
HHHHHHHHH
61.93Phosphositeplus
Link
479Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEPDKFQNK
CCCCCCCCC
60.61Phosphositeplus
Link
514Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDYVKDLSQ
CCCCCCHHH
46.88Phosphositeplus
Link
521Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SQLTKLHSF
HHHHHHHHH
53.44Phosphositeplus
Link
545Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ENKLKFSQF
HHHHHHHHH
44.58Phosphositeplus
Link
547PhosphoserineKLKFSQFLE
HHHHHHHHH
20.59Phosphositeplus
Link
555Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ETEYKVKIN
HHHCCEEEC
30.71Phosphositeplus
Link
557Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EYKVKINPS
HCCEEECCC
32.39Phosphositeplus
Link
569Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVQVKRIHE
EEEEEEECH
28.66Phosphositeplus
Link
609Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IIGGKAAPG
EEECCCCCH
35.84Phosphositeplus
Link
640Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MVGSKLKVI
HHCCCEEEE
46.53Phosphositeplus
Link
656Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLAEKVIPA
HHHHHHHHH
39.60Phosphositeplus
Link
724Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AALDKKGYE
HHHHHHCCC
49.28Phosphositeplus
Link
725Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALDKKGYEA
HHHHHCCCC
67.41Phosphositeplus
Link
727PhosphotyrosineDKKGYEAKE
HHHCCCCHH
22.92Phosphositeplus
Link
730Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GYEAKEYYE
CCCCHHHHC
34.02Phosphositeplus
Link
732PhosphotyrosineEAKEYYEAL
CCHHHHCCC
13.10Phosphositeplus
Link
733PhosphotyrosineAKEYYEALP
CHHHHCCCH
8.87Phosphositeplus
Link
754Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FFSPKQPDL
CCCCCCHHH
73.58Phosphositeplus
Link
796Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YMNPKAWNT
HHCHHHHHH
62.11Phosphositeplus
Link
804Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TMVLKNIAA
HHHHHHHHC
34.59Phosphositeplus
Link
811Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AASGKFSSD
HCCCCCCCH
39.31Phosphositeplus
Link
819Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DRTIKEYAQ
HHHHHHHHH
44.02Phosphositeplus
Link
834Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PSDLKISLS
EEEEEECCC
34.93Phosphositeplus
Link-
843Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NESNKVNGN
CCCCCCCCC
46.48Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SMAD3_HUMANphysical interactionMINT-51253MINT15527767
PYGL_HUMANin vitroHPRD:01987HPRD10980448
12204691
GYS2_HUMANENSP00000216392STRING
GLGB_HUMANENSP00000216392STRING
CALM_HUMANENSP00000216392STRING
AGM1_HUMANENSP00000216392STRING
AMYP_HUMANENSP00000216392STRING
GDE_HUMANENSP00000216392STRING
KPBB_HUMANENSP00000216392STRING
GYS1_HUMANENSP00000216392STRING
PHKG2_HUMANENSP00000216392STRING
UGPA_HUMANENSP00000216392STRING
ENPP3_HUMANENSP00000216392STRING
ENPP1_HUMANENSP00000216392STRING
- top -

Disease Reference
Kegg disease
OMIM disease
232700Glycogen storage disease 6 (GSD6)
Drug Reference
DrugBank
DB00131Adenosine monophosphate
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-75 AND TYR-76, AND MASSSPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures