Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glycogen phosphorylase, muscle form  

UniProtKB / Swiss-Prot ID :  PYGM_RABIT

Gene Name (Synonyms) : 
PYGM  

Species :  Oryctolagus cuniculus (Rabbit). 

Subcellular Localization :   

Protein Function :  Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. 

Protein Sequence MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIR...
Predicted Secondary Structure CCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSRPLS
---CCCCCC
42.48UniProtKB
Link-
15PhosphoserineRKQISVRGL
HHHHCCCCC
11.85Phosphositeplus
Link
15Phosphoserine; by PHK; in formphosphorylase A.RKQISVRGL
HHHHCCCCC
11.85UniProtKB
Link
681N6-(pyridoxal phosphate)lysine.TGNMKFMLN
CCCHHHHHH
31.46UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Complete cDNA sequence for rabbit muscle glycogen phosphorylase.";
Nakano K., Hwang P.K., Fletterick R.J.;
FEBS Lett. 204:283-287(1986).
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Phosphorylation
ReferencePubMed
"Sequence of the amino-terminal 349 residues of rabbit muscle glycogenphosphorylase including the sites of covalent and allostericcontrol.";
Koide A., Titani K., Ericsson L.H., Kumar S., Neurath H., Walsh K.A.;
Biochemistry 17:5657-5672(1978).
Cited for: PROTEIN SEQUENCE OF 2-351.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures