Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Photoactive yellow protein  

UniProtKB / Swiss-Prot ID :  PYP_HALHA

Gene Name (Synonyms) : 
pyp  

Species :  Halorhodospira halophila (Ectothiorhodospira halophila). 

Subcellular Localization :   

Protein Function :  Photoactive blue-light protein. Probably functions as a photoreceptor for a negative phototaxis response. 

Protein Sequence MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCT...
Predicted Secondary Structure CCCCCCCCHHHHHHHHCCCCCHHHCCCCEEEEECCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
69S-(4-hydroxycinnamyl)cysteine.DVAPCTDSP
HHCCCCCCH
4.81UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Chromophore
ReferencePubMed
"Complete chemical structure of photoactive yellow protein: novelthioester-linked 4-hydroxycinnamyl chromophore and photocyclechemistry.";
Baca M., Borgstahl G.E., Boissinot M., Burke P.M., Williams D.R.,Slater K.A., Getzoff E.D.;
Biochemistry 33:14369-14377(1994).
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND CHROMOPHORE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures