Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Dihydroorotate dehydrogenase (quinone), mitochondrial  

UniProtKB / Swiss-Prot ID :  PYRD_HUMAN

Gene Name (Synonyms) : 
DHODH  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion inner membrane; Single-pass membrane protein. 

Protein Function :  Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. 

Transmembrane Topology (topPTM) : PYRD_HUMAN 

Protein Sequence MAWRHLKKRAQDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRA...
Predicted Secondary Structure CCHHHHHHHHHHHEEHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCHHH...
Protein Variant
LocationDescription
7K -> Q (in dbSNP:rs3213422). VAR_022094
19G -> E (in POADS). VAR_062412
135R -> C (in POADS). VAR_062413
152G -> R (in POADS). VAR_062414
199R -> C (in POADS). VAR_062415
202G -> A (in POADS). VAR_062416
202G -> D (in POADS). VAR_062417
244R -> W (in POADS). VAR_062418
284T -> I (in POADS). VAR_062419
346R -> W (in POADS). VAR_062420
392D -> G (in POADS). VAR_062421
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
121PhosphothreonineIGSVTPKPQ
ECCCCCCCC
27.56HPRD
Link
121PhosphothreonineIGSVTPKPQ
ECCCCCCCC
27.56Phosphositeplus
Link
185Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGKNKTSVD
CCCCCCCCC
45.74Phosphositeplus
Link
306Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLSGKPLRD
CCCCCCHHH
37.19Phosphositeplus
Link
344Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DALEKIRAG
HHHHHHHHC
38.04Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PYR5_HUMANENSP00000219240STRING
PYR1_HUMANENSP00000219240STRING
- top -

Disease Reference
Kegg disease
OMIM disease
263750Postaxial acrofacial dysostosis (POADS)
Drug Reference
Kegg drug
D00749 Leflunomide (JAN/USAN/INN); Arava (TN)
D03154 Brequinar sodium (USAN)
D10172 Teriflunomide (USAN); Aubagio (TN)
DrugBank
DB01117Atovaquone
DB01097Leflunomide
DB08880Teriflunomide
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures