Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Reticulon-4 receptor-like 2  

UniProtKB / Swiss-Prot ID :  R4RL2_HUMAN

Gene Name (Synonyms) : 
RTN4RL2, NGRH1, NGRL3  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. Note=Localized to the surface of neurons, including axons. 

Protein Function :  May play a role in regulating axonal regeneration and plasticity in the adult central nervous system. 

Protein Sequence MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNN...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEECCCCCEEEECCCCCCCCCCCCCCCCEEEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
139PhosphotyrosineSLHLYRCQL
EEECCCCCC
9.90Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures