Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-14  

UniProtKB / Swiss-Prot ID :  RAB14_MOUSE

Gene Name (Synonyms) : 
Rab14  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Early endosome membrane; Lipid-anchor; Cytoplasmic side (By similarity). Golgi apparatus membrane; Lipid- anchor; Cytoplasmic side (By similarity). Golgi apparatus, trans- Golgi network membrane; Lipid-anchor; Cytoplasmic side (By similarity). 

Protein Function :  Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. 

Protein Sequence MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ...
Predicted Secondary Structure CCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
26S-nitrosocysteineVGKSCLLHQ
CCHHHHHHH
5.51dbSNO
Link-
40S-nitrosocysteineFMADCPHTI
CCCCCCCCC
1.61dbSNO
Link-
98PhosphothreonineTRRSTYNHL
CCHHHHHHH
26.91PhosphoELM
Link-
98PhosphothreonineTRRSTYNHL
CCHHHHHHH
26.91SysPTM
Link-
98Phosphothreonine.TRRSTYNHL
CCHHHHHHH
26.91UniProtKB
Link-
99PhosphotyrosineRRSTYNHLS
CHHHHHHHH
11.22PhosphoELM
Link-
99PhosphotyrosineRRSTYNHLS
CHHHHHHHH
11.22SysPTM
Link-
99Phosphotyrosine.RRSTYNHLS
CHHHHHHHH
11.22UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-98 AND TYR-99, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures