Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-1B  

UniProtKB / Swiss-Prot ID :  RAB1B_HUMAN

Gene Name (Synonyms) : 
RAB1B  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm. Note=Targeted by REP1 to membranes of specific subcellular compartments including endoplasmic reticulum, Golgi apparatus, and intermediate vesicles between these two compartments. In the GDP-form, colo 

Protein Function :  Protein transport. Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments. 

Protein Sequence MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF...
Predicted Secondary Structure CCCCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylmethionine.----MNPEY
----CCCCC
19.94UniProtKB
Link-
5PhosphotyrosineMNPEYDYLF
CCCCCCEEE
15.90HPRD
Link
5PhosphotyrosineMNPEYDYLF
CCCCCCEEE
15.90Phosphositeplus
Link
5PhosphotyrosineMNPEYDYLF
CCCCCCEEE
15.90SysPTM
Link
7PhosphotyrosinePEYDYLFKL
CCCCEEEEE
17.09HPRD
Link
7PhosphotyrosinePEYDYLFKL
CCCCEEEEE
17.09Phosphositeplus
Link
37PhosphotyrosineYTESYISTI
CCCCCCCCC
7.83Phosphositeplus
Link
72PhosphothreonineERFRTITSS
HHHHHHHHH
26.37Phosphositeplus
Link
76O-(2-cholinephosphoryl)serine; byLegionella AnkX.TITSSYYRG
HHHHHHHCC
19.96UniProtKB
Link
77O-AMP-tyrosine; by Legionella DrrA.ITSSYYRGA
HHHHHHCCC
9.28UniProtKB
Link
116Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ENVNKLLVG
CCCEEEEEE
38.63Phosphositeplus
Link
200S-geranylgeranyl cysteine.AGGGCC
CCCCCC
2.55UniProtKB
Link-
201S-geranylgeranyl cysteine.GGGCC
CCCCC
7.65UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RUSC2_HUMANphysical interactionMINT-61270MINT15796781
MICA1_HUMANphysical interactionMINT-61264MINT15796781
GDIA_HUMANin vivoHPRD:11469HPRD8836150
RAE1_HUMANin vivoHPRD:11469HPRD9437002
GOGA2_HUMANin vitro
yeast 2-hybrid
HPRD:11469HPRD11306556
RUSC2_HUMANin vitro
yeast 2-hybrid
HPRD:11469HPRD15796781
COPB_HUMANENSP00000310226STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY.
Prenylation
ReferencePubMed
"Prenylation of a Rab1B mutant with altered GTPase activity isimpaired in cell-free systems but not in intact mammalian cells.";
Wilson A.L., Sheridan K.M., Erdman R.A., Maltese W.A.;
Biochem. J. 318:1007-1014(1996).
Cited for: ISOPRENYLATION AT CYS-200 AND CYS-201, INTERACTION WITH GDI1, ANDMUTAGENESIS OF GLN-67.
"Membrane targeting of a Rab GTPase that fails to associate with Rabescort protein (REP) or guanine nucleotide dissociation inhibitor(GDI).";
Overmeyer J.H., Wilson A.L., Maltese W.A.;
J. Biol. Chem. 276:20379-20386(2001).
Cited for: SUBCELLULAR LOCATION, ISOPRENYLATION, INTERACTION WITH GDI1 AND CHM,AND MUTAGENESIS OF TYR-78.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures