Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-2A  

UniProtKB / Swiss-Prot ID :  RAB2A_CANFA

Gene Name (Synonyms) : 
RAB2A, RAB2  

Species :  Canis familiaris (Dog) (Canis lupus familiaris). 

Subcellular Localization :  Endoplasmic reticulum-Golgi intermediate compartment membrane; Lipid-anchor. Melanosome (By similarity). Endoplasmic reticulum membrane; Lipid-anchor (Potential). Golgi apparatus membrane; Lipid-anchor (Potential). 

Protein Function :  Required for protein transport from the endoplasmic reticulum to the Golgi complex. 

Protein Sequence MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS...
Predicted Secondary Structure CCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCEEEEEEEEECCCCHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
211S-geranylgeranyl cysteine.AGGGCC
CCCCCC
2.55UniProtKB
Link-
212S-geranylgeranyl cysteine.GGGCC
CCCCC
7.65UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Prenylation
ReferencePubMed
"Isoprenoid modification of rab proteins terminating in CC or CXCmotifs.";
Khosravi-Far R., Lutz R.J., Cox A.D., Conroy L., Bourne J.R.,Sinensky M., Balch W.E., Buss J.E., Der C.J.;
Proc. Natl. Acad. Sci. U.S.A. 88:6264-6268(1991).
Cited for: ISOPRENYLATION AT CYS-211 AND CYS-212.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures