Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-2A  

UniProtKB / Swiss-Prot ID :  RAB2A_RAT

Gene Name (Synonyms) : 
Rab2a, Rab2  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Endoplasmic reticulum-Golgi intermediate compartment membrane; Lipid-anchor (By similarity). Melanosome (By similarity). Endoplasmic reticulum membrane; Lipid-anchor (By similarity). Golgi apparatus membrane; Lipid-anchor (By similarity). 

Protein Function :  Required for protein transport from the endoplasmic reticulum to the Golgi complex (By similarity). 

Protein Sequence MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTMGVEFGARMITIDGKQIKLQIWDTAGQESFRS...
Predicted Secondary Structure CCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8N6,N6,N6-trimethyllysineAYLFKYIII
CEEEEEEEE
32.70MeMo
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures