Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-4A  

UniProtKB / Swiss-Prot ID :  RAB4A_HUMAN

Gene Name (Synonyms) : 
RAB4A, RAB4  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Peripheral membrane protein. Cytoplasm. Note=Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1. 

Protein Function :  Protein transport. Probably involved in vesicular traffic (By similarity). 

Protein Sequence MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERF...
Predicted Secondary Structure CCCCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCEEEEEEEEECCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
19PhosphothreonineGNAGTGKSC
ECCCCCHHH
38.74Phosphositeplus
Link
189PhosphotyrosineSGIQYGDAA
CCCCCCCCC
18.30Phosphositeplus
Link-
199PhosphoserineRQLRSPRRA
CCCCCCCCC
31.20Phosphositeplus
Link-
199Phosphoserine (CDK_group)RQLRSPRRA
CCCCCCCCC
31.20PhosphoELM
Link-
199Phosphoserine; by CDK1.RQLRSPRRA
CCCCCCCCC
31.20UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
P53_HUMANphysical interactionMINT-63547MINT16169070
Q9UG59_HUMANphysical interactionMINT-63549MINT16169070
P53_HUMANphysical interactionEBI-735569
intact16169070
APBB3_HUMANphysical interactionEBI-737504
intact16169070
SODM_HUMANphysical interactionEBI-737507
intact16169070
ACTB_HUMANin vitro
in vivo
HPRD:01541HPRD9013719
KPCI_HUMANin vivoHPRD:01541HPRD12832475
MK03_HUMANin vitroHPRD:01541HPRD8112321
SODM_HUMANin vitro
in vivo
HPRD:01541HPRD123234
P53_HUMANyeast 2-hybridHPRD:01541HPRD16169070
APBB3_HUMANyeast 2-hybridHPRD:01541HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures