Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-5A  

UniProtKB / Swiss-Prot ID :  RAB5A_HUMAN

Gene Name (Synonyms) : 
RAB5A, RAB5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor; Cytoplasmic side (By similarity). Early endosome membrane; Lipid-anchor (By similarity). Melanosome. Note=Enriched in stage I melanosomes. 

Protein Function :  Required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. 

Protein Sequence MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEECCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASRGA
---CCCCCC
14.13UniProtKB
Link-
51PhosphoserineEFQESTIGA
CCCCCCCCE
17.97HPRD
Link
116Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KNWVKELQR
HHHHHHHHH
44.30Phosphositeplus
Link
123PhosphoserineQRQASPNIV
HHHCCCCCE
15.33Phosphositeplus
Link
202PhosphothreonineGVDLTEPTQ
EEECCCCCC
35.14HPRD
Link-
202PhosphothreonineGVDLTEPTQ
EEECCCCCC
35.14PhosphoELM
Link-
202PhosphothreonineGVDLTEPTQ
EEECCCCCC
35.14Phosphositeplus
Link-
202PhosphothreonineGVDLTEPTQ
EEECCCCCC
35.14SysPTM
Link-
202Phosphothreonine.GVDLTEPTQ
EEECCCCCC
35.14UniProtKB
Link-
205PhosphothreonineLTEPTQPTR
CCCCCCCCC
40.73HPRD
Link-
205PhosphothreonineLTEPTQPTR
CCCCCCCCC
40.73PhosphoELM
Link-
205PhosphothreonineLTEPTQPTR
CCCCCCCCC
40.73Phosphositeplus
Link-
205PhosphothreonineLTEPTQPTR
CCCCCCCCC
40.73SysPTM
Link-
205Phosphothreonine.LTEPTQPTR
CCCCCCCCC
40.73UniProtKB
Link-
208PhosphothreoninePTQPTRNQC
CCCCCCCCC
32.22HPRD
Link-
208PhosphothreoninePTQPTRNQC
CCCCCCCCC
32.22PhosphoELM
Link-
208PhosphothreoninePTQPTRNQC
CCCCCCCCC
32.22Phosphositeplus
Link-
208PhosphothreoninePTQPTRNQC
CCCCCCCCC
32.22SysPTM
Link-
208Phosphothreonine.PTQPTRNQC
CCCCCCCCC
32.22UniProtKB
Link-
212S-farnesyl cysteineTRNQCCSN
CCCCCCCC
2.91HPRD
Link-
212S-geranylgeranyl cysteine.TRNQCCSN
CCCCCCCC
2.91UniProtKB
Link-
213S-farnesyl cysteineRNQCCSN
CCCCCCC
2.92HPRD
Link-
213S-geranylgeranyl cysteine.RNQCCSN
CCCCCCC
2.92UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RASA1_HUMANphysical interactionMINT-18675MINT11536198
Q4VY09_HUMANphysical interactionMINT-2882874MINT16902405
Q4VY09_HUMANcolocalizationMINT-2883167MINT16902405
Q4VY09_HUMANphysical interactionMINT-2981030MINT16902405
Q4VY09_HUMANphysical interactionMINT-2981062MINT16902405
Q4VY09_HUMANdirect interactionMINT-2883115MINT16902405
DP13A_HUMANdirect interactionMINT-5207882MINT17581628
DP13A_HUMANdirect interactionMINT-5208011MINT17581628
DP13A_HUMANdirect interactionMINT-5208179MINT17581628
DP13A_HUMANdirect interactionMINT-5208195MINT17581628
RABE1_HUMANdirect interactionEBI-1040324
intact15378032
EEA1_HUMANphysical interaction
physical interaction
physical interaction
EBI-399450
EBI-399487
EBI-399
intact10491193
11870209
9697774
AGTR1_HUMANin vivo
yeast 2-hybrid
HPRD:01542HPRD11682489
RAE2_HUMANin vitroHPRD:01542HPRD9730828
8294464
RASA1_HUMANin vitroHPRD:01542HPRD11536198
DP13A_HUMANin vitro
in vivo
HPRD:01542HPRD15016378
DP13B_HUMANin vitroHPRD:01542HPRD15016378
RAB5A_HUMANin vivoHPRD:01542HPRD15782196
RIN3_HUMANENSP00000273047STRING
TSC2_HUMANENSP00000273047STRING
PRAF1_HUMANENSP00000273047STRING
ELAF_HUMANENSP00000273047STRING
RBNS5_HUMANENSP00000273047STRING
RIN2_HUMANENSP00000273047STRING
RABE1_HUMANENSP00000273047STRING
ALS2_HUMANENSP00000273047STRING
TRFE_HUMANENSP00000273047STRING
P85A_HUMANENSP00000273047STRING
RASA1_HUMANENSP00000273047STRING
EGFR_HUMANENSP00000273047STRING
US6NL_HUMANENSP00000273047STRING
EPS8_HUMANENSP00000273047STRING
DP13A_HUMANENSP00000273047STRING
TBC3A_HUMANENSP00000273047STRING
RIN1_HUMANENSP00000273047STRING
EEA1_HUMANENSP00000273047STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Query failed : Got error 28 from storage engine
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed