Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Rab-9A  

UniProtKB / Swiss-Prot ID :  RAB9A_HUMAN

Gene Name (Synonyms) : 
RAB9A, RAB9  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). Endoplasmic reticulum membrane (Potential). Golgi apparatus membrane (Potential). Late endosome. Note=Co- localizes with OSBPL1A at the late endosome. 

Protein Function :  Involved in the transport of proteins between the endosomes and the trans Golgi network. 

Protein Sequence MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
107PhosphotyrosineKEFIYYADV
9.64Phosphositeplus
Link
175PhosphothreonineRVLATEDRS
33.97HPRD
Link-
175PhosphothreonineRVLATEDRS
33.97PhosphoELM
Link-
179PhosphoserineTEDRSDHLI
41.52HPRD
Link-
179PhosphoserineTEDRSDHLI
41.52PhosphoELM
Link-
179PhosphoserineTEDRSDHLI
41.52SysPTM
Link-
179Phosphoserine.TEDRSDHLI
41.52UniProtKB
Link-
187PhosphothreonineIQTDTVNLH
18.06HPRD
Link-
187PhosphothreonineIQTDTVNLH
18.06SysPTM
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BCL3_HUMANin vitroHPRD:02236HPRD11707390
11485202
GDIA_HUMANin vitroHPRD:02236HPRD7744738
PGRC1_HUMANENSP00000243325STRING
M6PBP_HUMANENSP00000243325STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-179, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures