Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related C3 botulinum toxin substrate 3  

UniProtKB / Swiss-Prot ID :  RAC3_HUMAN

Gene Name (Synonyms) : 
RAC3  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Note=Membrane-associated when activated. Co-localizes with NRBP to endomembranes and at the cell periphery in lamellipodia. 

Protein Function :  Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. 

Protein Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL...
Predicted Secondary Structure CCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
64PhosphotyrosineGQEDYDRLR
CCCHHHHHH
11.38Phosphositeplus
Link
96Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NVRAKWYPE
HHHHHHHHH
36.37Phosphositeplus
Link
153Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IGSVKYLEC
HCCCEEEEE
45.90Phosphositeplus
Link
166Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QRGLKTVFD
CCCHHHHHH
45.53Phosphositeplus
Link
167PhosphothreonineRGLKTVFDE
CCHHHHHHH
31.29Phosphositeplus
Link
167Phosphothreonine.RGLKTVFDE
CCHHHHHHH
31.29UniProtKB
Link
183Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PPPVKKPGK
CCCCCCCCC
60.05Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
HNF1A_HUMANin vitro
in vivo
HPRD:03629HPRD10777539
ANDR_HUMANin vitro
in vivo
HPRD:03629HPRD11747336
RBP1_HUMANENSP00000304283STRING
GMIP_HUMANENSP00000304283STRING
PKHG2_HUMANENSP00000304283STRING
PKHG2_HUMANENSP00000304283STRING
PKHG2_HUMANENSP00000304283STRING
RHG05_HUMANENSP00000304283STRING
PDIA2_HUMANENSP00000304283STRING
CHIO_HUMANENSP00000304283STRING
GDIR2_HUMANENSP00000304283STRING
ECT2_HUMANENSP00000304283STRING
NRBP_HUMANENSP00000304283STRING
CEND3_HUMANENSP00000304283STRING
KALRN_HUMANENSP00000304283STRING
ARHG9_HUMANENSP00000304283STRING
RGRF1_HUMANENSP00000304283STRING
RICH2_HUMANENSP00000304283STRING
NGEF_HUMANENSP00000304283STRING
CDGAP_HUMANENSP00000304283STRING
CDGAP_HUMANENSP00000304283STRING
FGD4_HUMANENSP00000304283STRING
GDIR1_HUMANENSP00000304283STRING
RHG26_HUMANENSP00000304283STRING
FGD2_HUMANENSP00000304283STRING
TIAM2_HUMANENSP00000304283STRING
TIAM2_HUMANENSP00000304283STRING
TIAM1_HUMANENSP00000304283STRING
TIAM1_HUMANENSP00000304283STRING
KALRN_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
RHG15_HUMANENSP00000304283STRING
FNBP2_HUMANENSP00000304283STRING
VAV_HUMANENSP00000304283STRING
CEND1_HUMANENSP00000304283STRING
BCR_HUMANENSP00000304283STRING
ABR_HUMANENSP00000304283STRING
RHG01_HUMANENSP00000304283STRING
MYO9B_HUMANENSP00000304283STRING
RHG24_HUMANENSP00000304283STRING
CIP4_HUMANENSP00000304283STRING
GRLF1_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
RHG10_HUMANENSP00000304283STRING
PRR5_HUMANENSP00000304283STRING
RHG08_HUMANENSP00000304283STRING
STA13_HUMANENSP00000304283STRING
STA13_HUMANENSP00000304283STRING
RHG06_HUMANENSP00000304283STRING
TRIO_HUMANENSP00000304283STRING
ARHG3_HUMANENSP00000304283STRING
RHG12_HUMANENSP00000304283STRING
SRGP1_HUMANENSP00000304283STRING
RHG09_HUMANENSP00000304283STRING
3BP1_HUMANENSP00000304283STRING
3BP1_HUMANENSP00000304283STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-167, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures