Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related protein Ral-B  

UniProtKB / Swiss-Prot ID :  RALB_HUMAN

Gene Name (Synonyms) : 
RALB  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor; Cytoplasmic side. Note=During late cytokinesis localizes at the midbody. 

Protein Function :  Multifuntional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis. 

Protein Sequence MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA...
Predicted Secondary Structure CCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
10PhosphoserineSKGQSSLAL
CCCCCCCEE
35.67Phosphositeplus
Link-
11PhosphoserineKGQSSLALH
CCCCCCEEE
15.13Phosphositeplus
Link
43PhosphotyrosineFVEDYEPTK
CCCCCCCCC
15.42Phosphositeplus
Link
198PhosphoserineKNKKSFKER
CCCCCCCCC
43.06Phosphositeplus
Link-
203Cysteine methyl ester.FKERCCLL
CCCCCEEC
1.69UniProtKB
Link-
203S-geranylgeranyl cysteine.FKERCCLL
CCCCCEEC
1.69UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RBP1_HUMANphysical interactionEBI-760240
intact16189514
RBP1_HUMANENSP00000272519STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Prenylation
ReferencePubMed
"Geranylgeranyltransferase I inhibitors target RalB to inhibitanchorage-dependent growth and induce apoptosis and RalA to inhibitanchorage-independent growth.";
Falsetti S.C., Wang D.A., Peng H., Carrico D., Cox A.D., Der C.J.,Hamilton A.D., Sebti S.M.;
Mol. Cell. Biol. 27:8003-8014(2007).
Cited for: SUBCELLULAR LOCATION, ISOPRENYLATION, ISOPRENYLATION AT CYS-203, ANDMUTAGENESIS OF CYS-203 AND LEU-206.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures