Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribulose bisphosphate carboxylase large chain  

UniProtKB / Swiss-Prot ID :  RBL_TOBAC

Gene Name (Synonyms) : 
rbcL, rbcA  

Species :  Nicotiana tabacum (Common tobacco). 

Subcellular Localization :  Plastid, chloroplast. 

Protein Function :  RuBisCO catalyzes two reactions: the carboxylation of D- ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site. 

Protein Sequence MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVW...
Predicted Secondary Structure CCCCCCCCCCCCHHHCCCHHHCCEECCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEC...
Protein Variant
LocationDescription
394F -> V.
405G -> M.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3N-acetylproline.--MSPQTET
--CCCCCCC
43.76UniProtKB
Link-
14N6,N6,N6-trimethyllysine.SVGFKAGVK
CCCHHHCCC
38.00UniProtKB
Link-
14N6-methyllysineSVGFKAGVK
CCCHHHCCC
38.00MeMo
Link-
201N6-carboxylysine.LDFTKDDEN
CCEEECCCC
64.28UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Methylation
ReferencePubMed
"Post-translational modifications in the large subunit of ribulosebisphosphate carboxylase/oxygenase.";
Houtz R.L., Stults J.T., Mulligan R.M., Tolbert N.E.;
Proc. Natl. Acad. Sci. U.S.A. 86:1855-1859(1989).
Cited for: PROTEIN SEQUENCE OF 3-18, AND METHYLATION AT LYS-14.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures