Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  RNA-binding protein 28  

UniProtKB / Swiss-Prot ID :  RBM28_HUMAN

Gene Name (Synonyms) : 
RBM28  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus. 

Protein Function :  Nucleolar component of the spliceosomal ribonucleoprotein complexes. 

Protein Sequence MAGLTLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEITTFEG...
Predicted Secondary Structure CCCCEEEEECCCCCCCHHHHHHHHHHHCCEEEEEEEECCCCCCCCCEEEEEECCHHHHHHHHHHHCCCCC...
Protein Variant
LocationDescription
253E -> Q (in dbSNP:rs11554671). VAR_045654
351L -> P (in ANES). VAR_045655
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGLTL
---CCCCEE
23.00UniProtKB
Link-
122PhosphoserineIRNLSFKCS
EECCCCCCC
26.63HPRD
Link-
122PhosphoserineIRNLSFKCS
EECCCCCCC
26.63PhosphoELM
Link-
122PhosphoserineIRNLSFKCS
EECCCCCCC
26.63Phosphositeplus
Link-
122PhosphoserineIRNLSFKCS
EECCCCCCC
26.63SysPTM
Link-
122Phosphoserine.IRNLSFKCS
EECCCCCCC
26.63UniProtKB
Link-
202PhosphoserineTQSVSAIGE
CCCCCCCCC
21.29HPRD
Link-
202Phosphoserine.TQSVSAIGE
CCCCCCCCC
21.29UniProtKB
Link-
280PhosphoserineAPAKSSDHS
CCCCCCCHH
43.00HPRD
Link-
281PhosphoserinePAKSSDHSE
CCCCCCHHH
38.34HPRD
Link-
288PhosphoserineSEEDSDLEE
HHHHHHHHH
47.58HPRD
Link-
305PhosphoserineELAQSDTST
HHHHHHHHH
36.93HPRD
Link-
307PhosphothreonineAQSDTSTEE
HHHHHHHHH
42.68HPRD
Link-
511PhosphothreonineLLSATSGEK
HHHHCCCCC
33.61HPRD
Link-
622N6-acetyllysineDQQQKAAQH
CCHHHCCCC
41.15Phosphositeplus
Link-
639N6-acetyllysinePPEQKRKAG
CCCCCCCCC
54.96Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
OMIM disease
612079Alopecia, neurologic defects, and endocrinopathy syndrome (ANES)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-202, AND MASSSPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-122, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures