Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  RNA-binding protein 42  

UniProtKB / Swiss-Prot ID :  RBM42_BOVIN

Gene Name (Synonyms) : 
RBM42  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Nucleus (By similarity). Cytoplasm (By similarity). Note=Upon stress response, localizes with HNRNPK in cytoplasmic aggregates of stalled translational preinitiation complexes called stress granules (By similarity). 

Protein Function :  Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA (By similarity). 

Protein Sequence MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVTGIPTAVPAVPTVPTVE...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures