Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Recoverin  

UniProtKB / Swiss-Prot ID :  RECO_BOVIN

Gene Name (Synonyms) : 
RCVRN, RCV1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :   

Protein Function :  Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse. 

Protein Sequence MGNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVF...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-myristoyl glycine.---MGNSKS
---CCCCCC
47.31UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Myristoylation
ReferencePubMed
"The NH2 terminus of retinal recoverin is acylated by a small familyof fatty acids.";
Dizhoor A.M., Ericsson L.H., Johnson R.S., Kumar S., Olshevskaya E.,Zozulya S., Neubert T.A., Stryer L., Hurley J.B., Walsh K.A.;
J. Biol. Chem. 267:16033-16036(1992).
Cited for: MYRISTOYLATION AT GLY-2.
"Role of the acylated amino terminus of recoverin in Ca(2+)-dependentmembrane interaction.";
Dizhoor A.M., Chen C.-K., Olshevskaya E., Sinelnikova V.V.,Phillipov P., Hurley J.B.;
Science 259:829-832(1993).
Cited for: ROLE OF MYRISTOYLATION.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures