Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Renin  

UniProtKB / Swiss-Prot ID :  RENI_HUMAN

Gene Name (Synonyms) : 
REN  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. Membrane. Note=Associated to membranes via binding to ATP6AP2. 

Protein Function :  Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. 

Protein Sequence MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG...
Predicted Secondary Structure CCCHHCCHHHHHHHHHHHHHHHHEECCCCCEEEEECEECCCHHHHHHHCCCCHHHHCCCCCCCHHCCCCC...
Protein Variant
LocationDescription
16L -> R (in HNFJ2; affects ERtranslocation and processing of nascent
33R -> W (in dbSNP:rs11571098). VAR_020375
104D -> N (in RTD). VAR_035088
160Q -> K (in dbSNP:rs11571083). VAR_029171
217G -> R (in dbSNP:rs11571117). VAR_020376
230R -> K (in RTD). VAR_035087
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
66noneQPMKRLTLG
CCHHCCCCC
27.01HPRD
Link-
66noneQPMKRLTLG
CCHHCCCCC
27.01HPRD
Link-
71N-linked (Glc...)LTLGNTTSS
CCCCCCCCC
43.21HPRD
Link
71N-linked (GlcNAc...).LTLGNTTSS
CCCCCCCCC
43.21UniProtKB
Link
117S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)PSSKCSRLY
ECCCCCCCC
2.86HPRD
Link
119noneSKCSRLYTA
CCCCCCCCC
40.98HPRD
Link
124S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)LYTACVYHK
CCCCCCCCC
2.11HPRD
Link
141N-linked (Glc...)SYKHNGTEL
EEEECCEEE
55.73HPRD
Link
141N-linked (GlcNAc...).SYKHNGTEL
EEEECCEEE
55.73UniProtKB
Link
234noneRDSENSQSL
CCCCCCCCC
49.66HPRD
Link
283S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)STLLCEDGC
EEEECCCCC
5.15HPRD
Link
287S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)CEDGCLALV
CCCCCEEEE
2.88HPRD
Link
325S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)YVVKCNEGP
EEEECCCCC
3.66HPRD
Link
362S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)SKKLCTLAI
CCCEEEEEE
3.93HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MPRD_HUMANin vitroHPRD:01564HPRD2960682
KCD15_HUMANyeast 2-hybridHPRD:01564HPRD16169070
- top -

Disease Reference
Kegg disease
H00541 Uromodulin-associated kidney diseases, including: Medullary cystic kidney disease 2; Familial juveni
H00575 Renal tubular dysgenesis
OMIM disease
267430Renal tubular dysgenesis (RTD)
613092Familial juvenile hyperuricemic nephropathy 2 (HNFJ2)
Drug Reference
Kegg drug
D03208 Aliskiren (USAN/INN); Rasilez (TN)
D03738 Enalkiren (USAN/INN)
D03741 Ditekiren (USAN)
D03743 Terlakiren (USAN/INN)
D03745 Zankiren hydrochloride (USAN)
D06412 Aliskiren fumarate (JAN/USAN); Aliskiren hemifumarate; Tekturna (TN)
D09038 Remikiren (INN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures