Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DNA-binding protein RFX5  

UniProtKB / Swiss-Prot ID :  RFX5_HUMAN

Gene Name (Synonyms) : 
RFX5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. 

Protein Function :  Activates transcription from class II MHC promoters. Recognizes X-boxes. Mediates cooperative binding between RFX and NF-Y. RFX binds the X1 box of MHC-II promoters. 

Protein Sequence MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCC...
Protein Variant
LocationDescription
149R -> Q (in BLS2). VAR_015550
197R -> Q (in dbSNP:rs2233851). VAR_034448
409P -> R (in dbSNP:rs2233854). VAR_034449
499P -> S (in dbSNP:rs2233855). VAR_034450
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
10PhosphoserinePDAKSPKTG
CCCCCCCCC
33.09HPRD
Link-
10PhosphoserinePDAKSPKTG
CCCCCCCCC
33.09Phosphositeplus
Link-
28PhosphothreonineAGEPTTLLQ
CCCHHHHHH
26.27HPRD
Link
159PhosphotyrosineGQSKYCYSG
CCCEEEEEE
11.23HPRD
Link-
159PhosphotyrosineGQSKYCYSG
CCCEEEEEE
11.23Phosphositeplus
Link-
161PhosphotyrosineSKYCYSGIR
CEEEEEEEE
13.57HPRD
Link-
168PhosphothreonineIRRKTLVSM
EEEEEEECC
30.49HPRD
Link-
185PhosphoserineKGSESPEMG
CCCCCCCCC
28.05HPRD
Link-
185PhosphoserineKGSESPEMG
CCCCCCCCC
28.05Phosphositeplus
Link-
219PhosphoserineILKRSFSSI
HHHHHHHHH
28.08HPRD
Link-
219PhosphoserineILKRSFSSI
HHHHHHHHH
28.08Phosphositeplus
Link-
221PhosphoserineKRSFSSIVE
HHHHHHHHH
22.02HPRD
Link-
308PhosphoserineERKKSVVES
HHHHHHHHC
34.14HPRD
Link-
308PhosphoserineERKKSVVES
HHHHHHHHC
34.14Phosphositeplus
Link-
339PhosphoserineRAPRSLIPP
CCCHHCCCC
29.59HPRD
Link-
473PhosphoserinePRKKSGGSG
CCCCCCCCC
51.96HPRD
Link-
603PhosphoserineVLQSSLSQE
HHHHHHHHH
21.05HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SIN3B_HUMANphysical interactionEBI-923295
intact16464847
C2TA_HUMANin vitroHPRD:03517HPRD9177217
RFXAP_HUMANin vivo
yeast 2-hybrid
HPRD:03517HPRD9118943
HDAC2_HUMANin vivoHPRD:03517HPRD16464847
CREB1_HUMANENSP00000290524STRING
NFYB_HUMANENSP00000290524STRING
RFXAP_HUMANENSP00000290524STRING
RFXAP_HUMANENSP00000290524STRING
RFXAP_HUMANENSP00000290524STRING
RFXK_HUMANENSP00000290524STRING
NFYC_HUMANENSP00000290524STRING
C2TA_HUMANENSP00000290524STRING
- top -

Disease Reference
Kegg disease
OMIM disease
209920Bare lymphocyte syndrome 2 (BLS2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures