Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Regucalcin  

UniProtKB / Swiss-Prot ID :  RGN_MOUSE

Gene Name (Synonyms) : 
Rgn, Smp30  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities (By similarity). 

Protein Sequence MSSIKVECVLRENYRCGESPVWEEASQSLLFVDIPSKIICRWDTVSNQVQRVAVDAPVSSVALRQLGGYV...
Predicted Secondary Structure CCCCEEEEEEECCCCCCCCCEEEECCCEEEEEECCCCEEEEEECCHHCCCEEEEEECCCCCCEECCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MSSIKVE
--CCCCEEE
25.73PhosphoELM
Link
3Phosphoserine--MSSIKVE
--CCCCEEE
25.73SysPTM
Link
3Phosphoserine.--MSSIKVE
--CCCCEEE
25.73UniProtKB
Link
133PhosphoserineRHQGSLYSL
CCCCCEEEE
19.98SysPTM
Link
219PhosphotyrosineWVACYNGGR
EEEECCCCE
13.70SysPTM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures