Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribonucleoside-diphosphate reductase large chain 1  

UniProtKB / Swiss-Prot ID :  RIR1_YEAST

Gene Name (Synonyms) : 
RNR1, CRT7, RIR1, SDS12 YER070W  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. 

Protein Sequence MYVYKRDGRKEPVQFDKITARISRLCYGLDPKHIDAVKVTQRIISGVYEGVTTIELDNLAAETCAYMTTV...
Predicted Secondary Structure CEEECCCCCEECCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
227PhosphoserineMKEDSIEGI
CCCCCHHHH
24.51SysPTM
Link
227Phosphoserine.MKEDSIEGI
CCCCCHHHH
24.51UniProtKB
Link
809PhosphoserineLDSSSEASR
CCCCCCCCC
40.93SysPTM
Link-
809Phosphoserine.LDSSSEASR
CCCCCCCCC
40.93UniProtKB
Link-
812PhosphoserineSSEASREAS
CCCCCCCCC
26.97SysPTM
Link-
812Phosphoserine.SSEASREAS
CCCCCCCCC
26.97UniProtKB
Link-
816PhosphoserineSREASPAPT
CCCCCCCCC
19.49SysPTM
Link-
816Phosphoserine.SREASPAPT
CCCCCCCCC
19.49UniProtKB
Link-
837PhosphoserineNVQESKVEV
HHHHHHCCC
25.55SysPTM
Link-
837Phosphoserine.NVQESKVEV
HHHHHHCCC
25.55UniProtKB
Link-
887PhosphoserineCEMCSG
CCCCCC
46.34SysPTM
Link-
887Phosphoserine.CEMCSG
CCCCCC
46.34UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway.";
Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.;
Mol. Cell. Proteomics 4:310-327(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-816, AND MASSSPECTROMETRY.
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases.";
Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.;
Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-816, AND MASSSPECTROMETRY.
"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-227; SER-809; SER-812;SER-816; SER-837 AND SER-887, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures