Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  RING finger protein 126  

UniProtKB / Swiss-Prot ID :  RN126_HUMAN

Gene Name (Synonyms) : 
RNF126  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQ...
Predicted Secondary Structure CCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCHHHCCCHHHHCCCCCCCCCCCCHHCCCHHHHHHH...
Protein Variant
LocationDescription
68V -> M (in dbSNP:rs2285751). VAR_057217
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5PhosphoserineMAEASPHPG
CCCCCCCCC
18.42HPRD
Link-
5PhosphoserineMAEASPHPG
CCCCCCCCC
18.42Phosphositeplus
Link-
5PhosphoserineMAEASPHPG
CCCCCCCCC
18.42SysPTM
Link-
5Phosphoserine.MAEASPHPG
CCCCCCCCC
18.42UniProtKB
Link-
301PhosphoserineSSSSSPSNE
CCCCCCCCC
34.00HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BAT3_HUMANphysical interactionMINT-62619MINT14667819
BAT3_HUMANphysical interactionMINT-62717MINT14667819
BAT3_HUMANphysical interactionMINT-62793MINT14667819
UB2D1_HUMANphysical interactionMINT-67066MINT16189514
Q5QPM7_HUMANphysical interactionMINT-67711MINT16189514
UB2D4_HUMANphysical interactionMINT-67425MINT16189514
BAT3_HUMANyeast 2-hybridHPRD:11501HPRD14667819
UB2D4_HUMANyeast 2-hybridHPRD:11501HPRD16189514
PSMF1_HUMANyeast 2-hybridHPRD:11501HPRD16189514
BAT3_HUMANENSP00000341380STRING
BAT3_HUMANENSP00000341380STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures