Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribonuclease pancreatic  

UniProtKB / Swiss-Prot ID :  RNAS1_BOVIN

Gene Name (Synonyms) : 
RNASE1, RNS1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Secreted. 

Protein Function :  Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single stranded and double stranded RNA. 

Protein Sequence MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVN...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
27N-linked (Glc) (glycation); in vitro.PSLGKETAA
CCCCCCCHH
58.13UniProtKB
Link
33N-linked (Glc) (glycation); in vitro.TAAAKFERQ
CHHHHHEEE
42.93UniProtKB
Link
60N-linked (GlcNAc...); partial.MKSRNLTKD
HHHCCCCCC
60.18UniProtKB
Link
63N-linked (Glc) (glycation); in vitro.RNLTKDRCK
CCCCCCCCE
46.47UniProtKB
Link
67N-linked (Glc) (glycation); in vitro.KDRCKPVNT
CCCCEEEEE
53.55UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycation of amino groups in protein. Studies on the specificity ofmodification of RNase by glucose.";
Watkins N.G., Thorpe S.R., Baynes J.W.;
J. Biol. Chem. 260:10629-10636(1985).
Cited for: GLYCATION AT LYS-27; LYS-33; LYS-63 AND LYS-67.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures