Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Rho-related GTP-binding protein RhoE  

UniProtKB / Swiss-Prot ID :  RND3_HUMAN

Gene Name (Synonyms) : 
RND3, ARHE, RHO8, RHOE  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Golgi apparatus membrane; Peripheral membrane protein. 

Protein Function :  Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. 

Protein Sequence MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCEEEEEEEEEEECCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
7PhosphoserineERRASQKLS
CCCCCCCCC
26.49Phosphositeplus
Link-
11PhosphoserineSQKLSSKSI
CCCCCCCCC
42.63Phosphositeplus
Link-
241S-farnesyl cysteine.KAKSCTVM
HCCCCCCC
3.07UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
1433S_HUMANphysical interactionMINT-3974807MINT15778465
ROCK1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:04233HPRD12773565
RHG05_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:04233HPRD12842009
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Prenylation
ReferencePubMed
"Identification of a novel human Rho protein with unusual properties:GTPase deficiency and in vivo farnesylation.";
Foster R., Hu K.-Q., Lu Y., Nolan K.M., Thissen J., Settleman J.;
Mol. Cell. Biol. 16:2689-2699(1996).
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 16-244, CHARACTERIZATION, ANDISOPRENYLATION AT CYS-241.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures