Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein rogdi homolog  

UniProtKB / Swiss-Prot ID :  ROGDI_HUMAN

Gene Name (Synonyms) : 
ROGDI  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus envelope. 

Protein Function :  May act as a positive regulator of cell proliferation (By similarity). 

Protein Sequence MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQ...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
59E -> K (in dbSNP:rs2305659). VAR_038273
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CSN6_HUMANphysical interactionMINT-64595MINT16169070
K1377_HUMANphysical interactionMINT-64596MINT16169070
CSN6_HUMANphysical interactionEBI-730002
intact16169070
K1377_HUMANphysical interactionEBI-730005
intact16169070
DISC1_HUMANphysical interactionEBI-1105806
intact17043677
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures