Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DNA-directed RNA polymerases I and III subunit RPAC1  

UniProtKB / Swiss-Prot ID :  RPAC1_HUMAN

Gene Name (Synonyms) : 
POLR1C, POLR1E  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus (By similarity). 

Protein Function :  DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity). 

Protein Sequence MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
279R -> Q (in TCS3). VAR_064899
279R -> W (in TCS3). VAR_064900
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAASQA
---
18.80UniProtKB
Link-
4Phosphoserine-MAASQAVE
-
14.77Phosphositeplus
Link-
33PhosphotyrosineFPGNYSGYD
14.91HPRD
Link-
33PhosphotyrosineFPGNYSGYD
14.91PhosphoELM
Link-
33PhosphotyrosineFPGNYSGYD
14.91Phosphositeplus
Link-
33Phosphotyrosine.FPGNYSGYD
14.91UniProtKB
Link-
47Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DRFEKNFRV
59.69Phosphositeplus
Link-
124PhosphotyrosineRLFEYRNQG
13.92Phosphositeplus
Link-
154Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PHAAKDSSD
59.95Phosphositeplus
Link-
167Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YVNHKVYTR
31.56Phosphositeplus
Link-
224Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KDHAKFSPV
42.85Phosphositeplus
Link-
226PhosphoserineHAKFSPVAT
20.12HPRD
Link-
254PhosphoserineAEELSRCFS
30.22HPRD
Link-
282PhosphothreoninePRLDTFSRE
28.27Phosphositeplus
Link-
284PhosphoserineLDTFSREIF
30.97Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
IKBB_HUMANphysical interactionMINT-47872MINT14743216
IKBB_HUMANphysical interactionDIP:44804EDIP14743216
RPAC2_HUMANphysical interactionEBI-756559
intact16189514
WRN_HUMANin vivoHPRD:09661HPRD11971179
- top -

Disease Reference
Kegg disease
OMIM disease
248390Treacher Collins syndrome 3 (TCS3)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-33, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures