Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DNA-directed RNA polymerase III subunit RPC6  

UniProtKB / Swiss-Prot ID :  RPC6_HUMAN

Gene Name (Synonyms) : 
POLR3F  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus (By similarity). 

Protein Function :  DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct RNA Pol III binding to the TFIIIB-DNA complex. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. 

Protein Sequence MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNT...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
150PhosphotyrosineKKKVYMLYN
7.12Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q8IVC3_HUMANphysical interactionMINT-65454MINT16169070
TIP60_HUMANphysical interactionMINT-65455MINT16169070
ERG28_HUMANphysical interactionEBI-729135
intact16169070
RIF1_HUMANphysical interactionEBI-729138
intact16169070
TIP60_HUMANphysical interactionEBI-730567
intact16169070
STC2_HUMANphysical interactionEBI-730570
intact16169070
WDR89_HUMANphysical interactionEBI-735411
intact16169070
PRP4B_HUMANphysical interaction
physical interaction
EBI-735414
EBI-710079
intact16169070
16169070
TF3B_HUMANin vitro
in vivo
HPRD:15156HPRD9171375
TF3C4_HUMANin vitro
in vivo
HPRD:15156HPRD10523658
CA103_HUMANyeast 2-hybridHPRD:15156HPRD16169070
WDR89_HUMANyeast 2-hybridHPRD:15156HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures