Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribonuclease P protein subunit p30  

UniProtKB / Swiss-Prot ID :  RPP30_HUMAN

Gene Name (Synonyms) : 
RPP30, RNASEP2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus (Potential). 

Protein Function :  Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. 

Protein Sequence MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRP...
Predicted Secondary Structure CEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCHHCCHHHHHHHHCCCCCCCCCCC...
Protein Variant
LocationDescription
12G -> D (in dbSNP:rs11544145). VAR_051870
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAVFAD
---CEEEEE
12.72UniProtKB
Link-
78PhosphothreonineLTRLTIIVS
EECCEEEEC
12.84HPRD
Link-
85PhosphoserineVSDPSHCNV
ECCCCCCCE
45.74HPRD
Link-
138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PFYFKRPPI
CCCCCCHHH
53.25Phosphositeplus
Link-
161Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPAIKDSTM
ECCCCCCHH
47.97Phosphositeplus
Link-
243PhosphoserineFGIISTVKK
CCEEEEEEC
25.81HPRD
Link-
244PhosphothreonineGIISTVKKP
CEEEEEECC
26.40HPRD
Link-
251PhosphoserineKPRPSEGDE
CCCCCCCCC
56.33HPRD
Link-
251PhosphoserineKPRPSEGDE
CCCCCCCCC
56.33PhosphoELM
Link-
251PhosphoserineKPRPSEGDE
CCCCCCCCC
56.33Phosphositeplus
Link-
251PhosphoserineKPRPSEGDE
CCCCCCCCC
56.33SysPTM
Link-
251Phosphoserine.KPRPSEGDE
CCCCCCCCC
56.33UniProtKB
Link-
261PhosphoserineCLPASKKAK
CCCCCCCCC
32.52Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RPP14_HUMANphysical interactionEBI-366563
intact15096576
POP1_HUMANyeast 2-hybridHPRD:09359HPRD11455963
RPP29_HUMANyeast 2-hybridHPRD:09359HPRD11455963
RPP29_HUMANENSP00000277882STRING
RPP14_HUMANENSP00000277882STRING
POP7_HUMANENSP00000277882STRING
RPP25_HUMANENSP00000277882STRING
RPP40_HUMANENSP00000277882STRING
POP1_HUMANENSP00000277882STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, AND MASSSPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, AND MASSSPECTROMETRY.
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry.";
Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.;
Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, AND MASSSPECTROMETRY.
"Combining protein-based IMAC, peptide-based IMAC, and MudPIT forefficient phosphoproteomic analysis.";
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,Yates J.R. III;
J. Proteome Res. 7:1346-1351(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures