Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ras-related GTP-binding protein D  

UniProtKB / Swiss-Prot ID :  RRAGD_HUMAN

Gene Name (Synonyms) : 
RRAGD  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Lysosome. Note=Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA. 

Protein Function :  Has guanine nucleotide-binding activity but lacks intrinsic GTPase activity. Probably required for the amino acid- induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. 

Protein Sequence MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
96PhosphoserineLFLESTNKI
EEEEEEECC
39.15HPRD
Link
96PhosphoserineLFLESTNKI
EEEEEEECC
39.15PhosphoELM
Link
96PhosphoserineLFLESTNKI
EEEEEEECC
39.15Phosphositeplus
Link
97PhosphothreonineFLESTNKIC
EEEEEECCE
31.02HPRD
Link
97PhosphothreonineFLESTNKIC
EEEEEECCE
31.02PhosphoELM
Link
97PhosphothreonineFLESTNKIC
EEEEEECCE
31.02Phosphositeplus
Link
97PhosphothreonineFLESTNKIC
EEEEEECCE
31.02SysPTM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RRAGA_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
EBI-993102
EBI-993021
EBI-992
intact11073942
11073942
11073942
11073942
RRAGB_HUMANphysical interactionEBI-993079
intact11073942
NOL8_HUMANin vivoHPRD:12199HPRD14660641
RRAGB_HUMANin vivoHPRD:12199HPRD11073942
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures