Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein RRP5 homolog  

UniProtKB / Swiss-Prot ID :  RRP5_MOUSE

Gene Name (Synonyms) : 
Pdcd11, Alg4, Kiaa0185  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus, nucleolus (By similarity). 

Protein Function :  Essential for the generation of mature 18S rRNA, specifically necessary for cleavages at sites A0, 1 and 2 of the 47S precursor. Directly interacts with U3 snoRNA (By similarity). 

Protein Sequence MANLEESFPRGGTRKLHKSEKSSQQVVEQDNLFDVSTEEGPIKRKKSQKGPAKTKKLKIEKRKSIKSIKE...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
531PhosphoserineTSKLSLITC
22.82Phosphositeplus
Link-
536PhosphotyrosineLITCYEGAK
14.56Phosphositeplus
Link-
545PhosphothreoninePGLQTHGVI
26.16Phosphositeplus
Link-
1229S-nitrosocysteineRAFLCLSLI
1.64dbSNO
Link-
1328PhosphoserinePEINSIEDV
32.77Phosphositeplus
Link-
1468PhosphoserineERQESESEQ
37.78Phosphositeplus
Link-
1470PhosphoserineQESESEQEL
54.59Phosphositeplus
Link-
1490PhosphoserineEEDDSGVEV
57.99Phosphositeplus
Link-
1722PhosphotyrosineVWIKYGAFV
12.45Phosphositeplus
Link-
1730PhosphoserineVLGRSQAGA
23.68Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures