Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  40S ribosomal protein Sa-1  

UniProtKB / Swiss-Prot ID :  RSSA1_ARATH

Gene Name (Synonyms) : 
RPSaA At1g72370 T10D10.16  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA- precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits (By similarity). 

Protein Sequence MATNGSASSAQLSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAARVIV...
Predicted Secondary Structure CCCCCCCCHHHHHCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine---MATNGS
---CCCCCC
15.12SysPTM
Link-
3Phosphothreonine.--MATNGSA
--CCCCCCC
38.52UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-3, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures