Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Reticulon-4 receptor  

UniProtKB / Swiss-Prot ID :  RTN4R_HUMAN

Gene Name (Synonyms) : 
RTN4R, NOGOR UNQ330/PRO526  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :  Receptor for RTN4, OMG and MAG. Mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult central nervous system. Acts in conjunction with RTN4 and LIGO1 in regulating neuronal precursor cell motility during cortical development (By similarity). 

Protein Sequence MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRIS...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEEEEECCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
82N-linked (Glc...)RACRNLTIL
HCCCCCEEE
41.23HPRD
Link
82N-linked (GlcNAc...).RACRNLTIL
HCCCCCEEE
41.23UniProtKB
Link
179N-linked (Glc...)RDLGNLTHL
HHCCCCCEE
49.41HPRD
Link
179N-linked (GlcNAc...).RDLGNLTHL
HHCCCCCEE
49.41UniProtKB
Link
372N-linked (Glc...)SPPGNGSGP
CCCCCCCCC
47.43HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MAG_HUMANin vitro
in vivo
HPRD:16123HPRD12160746
12089450
TNR16_HUMANin vitro
in vivo
HPRD:16123HPRD12422217
RTN4_HUMANin vivoHPRD:16123HPRD11201742
TNR16_HUMANENSP00000043402STRING
OMGP_HUMANENSP00000043402STRING
AMPN_HUMANENSP00000043402STRING
RTN4_HUMANENSP00000043402STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Structure of the Nogo receptor ectodomain: a recognition moduleimplicated in myelin inhibition.";
He X.L., Bazan J.F., McDermott G., Park J.B., Wang K.,Tessier-Lavigne M., He Z., Garcia K.C.;
Neuron 38:177-185(2003).
Cited for: X-RAY CRYSTALLOGRAPHY (1.52 ANGSTROMS) OF 26-310, DISULFIDE BONDS, ANDGLYCOSYLATION AT ASN-82 AND ASN-179.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures